KEGG   Danio rerio (zebrafish): 334597Help
Entry
334597            CDS       T01004                                 

Gene name
ppp1cbl, Pp1alpha-96A, wu:fa14b10, zgc:64169
Definition
protein phosphatase 1, catalytic subunit, beta isoform, like (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dre  Danio rerio (zebrafish)
Pathway
mRNA surveillance pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Focal adhesion
Regulation of actin cytoskeleton
Insulin signaling pathway
Herpes simplex infection
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:dre03015]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:dre04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:dre04114]
Cellular Processes; Cell communication; Focal adhesion [PATH:dre04510]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:dre04910]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:dre04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:dre04270]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:dre05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
7
AA seq 281 aa AA seqDB search
MAEGELDVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELETICLL
LAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDE
KIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTF
GADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDE
TLMCSFQILKPSEKKAKYQYGGMNSGRPVTPPRTATPPKKR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggcggagggcgagctggacgtggattctctgatctccaggctgctggaggtgcgagga
tgccgtccaggaaagatcgtccagatgacggaggctgaggttcggggtttgtgcataaag
tctcgagagattttcctgagtcaacccatcctgctggagctggagaccatctgcctgctg
ctggcctacaagatcaagtacccggagaacttcttcctgctgcgggggaaccacgagtgc
gcctccatcaaccgcatctacggcttctacgacgagtgcaagcgcaggttcaacatcaag
ctgtggaaaaccttcaccgactgcttcaactgtctgccgattgccgccatcgtggacgag
aagatcttctgctgccacggaggcctctctccagacctgcagtccatggagcagatcaga
cgcatcatgaggcccactgacgtacctgacacaggtctgctgtgtgatctgctgtggtct
gacccagataaggatgttcagggttggggtgagaatgaccgcggcgtctccttcaccttc
ggcgctgatgtcgtcagcaaattcctgaaccgccacgacctggacctgatctgccgtgca
caccaggtggtggaggatgggtacgagttcttcgctaagcgtcagctggtcacgctgttt
tcggcacccaattactgcggcgagttcgacaacgctggaggcatgatgagcgtagacgaa
acactcatgtgctcctttcagatcctgaagccgtcagagaagaaggccaagtatcagtat
ggcggcatgaactccggtcggcctgtgactccgccccgcacggccacgcccccaaagaag
cggtga

DBGET integrated database retrieval system