KEGG   Danio rerio (zebrafish): 334632Help
Entry
334632            CDS       T01004                                 

Gene name
ap2b1, fa16e07, wu:fa16c06, wu:fa16e07, wu:fc18c08, zgc:55659
Definition
adaptor-related protein complex 2, beta 1 subunit
Orthology
K11825  
AP-2 complex subunit beta-1
Organism
dre  Danio rerio (zebrafish)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    334632 (ap2b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
5
AA seq 951 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDEREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNTLLKKLSPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASHANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARGAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIQHGSI
DTGESPVSTGPAASIDQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQIAAVDLLGGGL
DSLLGGDLGGGVGGSPAVGQNFIPSSVPNTFAPSPTPAALSSGLNDLFELSTGMATATGG
YVAAKTVWLPAVKAKGLEISGTFSRRQGHMYMDMTFTNKALQHMTDFAIQFNKNSFGVIP
TTPLPVHTPLMPSQSIDISLPLNTIGPVMKMDPLNNLQVAVKNNIDVFYFSTLIPLNVFF
VEDGKMERQVFLATWKDIPNENELQYQIKDCHLNADTVSGKLQSNNVYTIAKRNVEGQDM
LYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYVYQMYDATLKN
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgactgactcaaagtatttcaccaccaacaaaaaaggagaaatctttgagctgaaggcc
gagctgaataatgagaagaaggagaagaggaaagaggcagtgaagaaagtcatcgccgcc
atgacggtgggcaaggatgtcagttcgttgtttccagatgtggtgaactgcatgcagacg
gacaacctggagctgaagaagctggtttacctgtaccttatgaattatgccaagagtcag
ccggacatggccatcatggcagttaacagctttgtcaaggactgtgaggatccaaaccct
ctgatccgtgctctggctgtgcgcacgatgggttgtatccgcgtggacaagatcactgag
tacctctgtgaacctctgcgaaagtgtctgaaggatgaagacccgtacgtgaggaagact
gcagccgtgtgtgtggccaaactgcatgacatcaatgctcagatggtggaggaccagggc
ttcctggactctctccgggacctgatcgctgactccaatcccatggttgtggccaatgca
gttgctgctctgtctgagatcagcgagtctcaccccaacagcaaccttctggacctgaac
cctcagaacatcaacaagcttctgacggctcttaatgagtgcactgaatggggccagatc
ttcatcctggactgcctctccaactacaaccccaaagacgagcgggaggcccagagtatc
tgtgagcgggtgacgccacgtctctcgcatgctaattcagctgtggtgctttcggcggta
aaggtactgatgaagtttttggagctcctgcccaaagactctgattactacaacactctt
ctgaagaagctctctcctcccctcgtcacactgttatctggcgaaccagaggtccaatat
gtggcgctcaggaatatcaaccttattgtgcagaaacggcctgagattttgaagcaagag
attaaagtgttctttgtcaagtacaatgaccctatatatgtcaagttggagaaactggac
atcatgatccgactagcctctcatgccaacatcgcccaggtcctggctgagctgaaggaa
tatgccactgaggtggatgtagactttgttcggaaagccgtgcgagccattggtcgctgt
gccatcaaagtggagcaatccgctgagcgctgtgttagcaccctgctggaccttatccag
accaaagtcaactacgtcgtgcaggaagccattgtggtcatcagggacatcttccgcaaa
tatcccaacaagtatgagagcataatcgccactctgtgtgaaaacctggactctctggat
gaacctgacgctcgaggagccatgatctggattgttggcgaatatgcagagcgtatcgac
aacgctgatgagctactggagagtttcctcgagggcttccatgatgaaagcactcaggtc
cagttgactctgctgacagccatagtgaagctgttcctgaagaagccctctgagactcag
gagctggttcagcaggtgctcagtctggccactcaggactctgataaccctgacctgcgt
gaccgcggctacatctactggcgtctgctgtccactgatcctgtcaccgctaaagaggtg
gtgctgtctgagaaacctctgatctcagaggagacggacctgattgagcccaccctgctg
gacgagctcatctgccacattggctcgctggcctcagtctaccacaagcccccaaatgcc
tttgtggagggaagccatggcattcatcgcaaacatctgcccatccagcacggcagtatc
gacaccggggagagtcccgtcagtaccggcccggctgcttccattgatcaaccccaggtc
atcccatctcagggtgaccttctgggagacctgcttaatctggacctcgggccaccggtc
aatgtgccccaggtgtcctccatgcagatagcggctgtggatctcctgggaggtggtctt
gacagtttgctcgggggagatctgggaggaggtgttgggggcagtcctgcagtgggccag
aacttcatcccatcatcggtgcccaacacctttgcaccatctccgacacctgccgctctt
agcagcggactcaatgacctgtttgagttgtccacaggaatggccactgctacaggagga
tatgtggctgctaaaactgtgtggctgccagcagtcaaggccaaaggactggagatttct
ggaaccttctctcggcgtcaagggcacatgtatatggacatgaccttcaccaataaagca
ttgcagcatatgactgactttgccatccagttcaacaagaacagttttggtgtaatcccc
accacacctctccccgtccacactccactgatgcccagtcagagcatcgacatctccctc
ccgctcaacaccatcggccctgtgatgaaaatggatccactcaacaacctacaggtggcc
gtgaaaaacaatattgatgtcttctactttagcacgctgatccctctcaatgtcttcttc
gtggaggatggcaaaatggagcgtcaggtgttcttggccacatggaaggacattcctaat
gagaatgagctgcaataccagatcaaagactgccacttaaacgcagatacggtgtcgggc
aaactgcagagcaacaatgtctacaccatcgcaaagaggaacgtggaaggccaggacatg
ttgtaccagtcgctcaaactcaccaacgggatctggattctcgccgagctccgcatacaa
cccggcaatcccaattacacgctgtctctgaagtgcagggctccagaggtttctcagtac
gtgtaccagatgtacgatgccactctgaagaactga

DBGET integrated database retrieval system