KEGG   Danio rerio (zebrafish): 334839Help
Entry
334839            CDS       T01004                                 

Gene name
gtf2h4
Definition
(RefSeq) general transcription factor IIH subunit 4
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03022  Basal transcription factors
dre03420  Nucleotide excision repair
Module
dre_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    334839 (gtf2h4)
  Replication and repair
   03420 Nucleotide excision repair
    334839 (gtf2h4)
Transcription machinery [BR:dre03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     334839 (gtf2h4)
DNA repair and recombination proteins [BR:dre03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     334839 (gtf2h4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tfb2 Helicase_C_3
Motif
Other DBs
NCBI-GeneID: 334839
NCBI-ProteinID: NP_956221
ZFIN: ZDB-GENE-030131-6779
Ensembl: ENSDARG00000036071
Vega: OTTDARG00000014918
UniProt: Q6P2T8
Position
19
AA seq 466 aa AA seqDB search
MKLRVQLQCKNLHEYLKELTPEILDRLYNHPATCLAVYRELPPLAKNYVMRMLFLDHPLP
QAAVALWVKKGSQKDHDQCVSVLTGLRLWHSQHLQGGLQGFVLNPVFKDNLRIALLGGGK
PWADEGANLGPDRHARDVESLDRYAMERWEVILHFMVGSPSAAVSQDLAQLLIQAGLMKS
ETGEAPCITSAGFQFLLLDTASQLWYFTLQYLKTAQSRGMDLVEILSFLFQLSFSTLGRD
YSVEGMSESLLTFLQHLREFGLVFQRKRKSRRYYPTRLAITLAAGVTANPASGSASSALG
AIPGTGDTGFIVVETNYRIYAYTNSELQIALVALFSEMLYRFPNLVVAQVTRESVQQAIS
NGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELEKDRLQFTEGVLYNQFLSQA
DFEVLRDRAQGLGVLVWQNPAHRVMVVTPHGHSEVKRFWKRQKSHS
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcgcgttcagcttcagtgtaagaacttgcacgagtatctgaaagaactgacc
ccagaaatcctcgacaggctctacaatcacccagcaacatgtctagcagtatacagggaa
cttccaccactggcaaagaattacgtgatgcgcatgctgtttttagaccatccactcccc
caggctgcggttgccctgtgggttaaaaaaggcagtcaaaaagaccatgatcaatgtgtg
tcggtgttaactgggctacggctctggcacagtcagcatcttcaaggtggacttcaaggt
ttcgtgctcaaccccgtgtttaaggacaacctgagaatagcacttctaggcggtggtaaa
ccgtgggcagacgagggtgccaatctgggtcccgatcggcatgcgagggatgtagagagt
ctggaccgctatgctatggagcgctgggaggtcatccttcacttcatggtgggctctcct
agcgcagctgtcagtcaggatctggctcagctcctcatacaggccgggctcatgaagagc
gagactggtgaggctccatgcatcacatcagcagggtttcagttcctgctgctggacacg
gcatctcagttgtggtacttcaccctgcagtacctcaaaacagcacagtcgagaggaatg
gacctggtggagattctttcctttttgttccagctgagtttttccactcttggaagggat
tattctgtggagggcatgagcgagtccctgctcacatttttgcagcatctacgagagttt
ggtctggtttttcaaagaaagaggaagtcaagaaggtactaccctacgagactcgccata
actctcgctgcaggagtcactgcaaacccagcctcgggatctgcctcttctgcactggga
gcaataccaggaacaggagacactggattcatcgttgtagaaactaattatcgcatatat
gcctatacaaactctgaacttcagattgcactggtcgctctgtttagtgagatgttgtat
cggtttcctaacctggtggttgcacaggtcacccgagagtctgtgcagcaggccatcagt
aacggcatcaccgcacagcagattattcacttcttacggacccgagcacacccagttatg
cttaaacagacccccgttctccccccaaccatcacagatcagatcagactgtgggagctt
gagaaagatcgcttgcagtttaccgagggagtgttatacaaccagtttttatcccaggct
gatttcgaagtgttgcgggacagggctcagggtttaggagtgctggtgtggcagaatccc
gctcacagggtcatggtggtgactcctcatggacacagcgaggttaagagattctggaag
agacaaaaaagccattcataa

DBGET integrated database retrieval system