KEGG   Danio rerio (zebrafish): 334839Help
Entry
334839            CDS       T01004                                 

Gene name
gtf2h4, wu:fa04h09, zgc:77721
Definition
general transcription factor IIH, polypeptide 4
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
dre  Danio rerio (zebrafish)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    334839 (gtf2h4)
  Replication and repair
   03420 Nucleotide excision repair
    334839 (gtf2h4)
Transcription machinery [BR:dre03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     334839 (gtf2h4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
19
AA seq 466 aa AA seqDB search
MKLRVQLQCKNLHEYLKELTPEILDRLYNHPATCLAVYRELPPLAKNYVMRMLFLDHPLP
QAAVALWVKKGSQKDHDQCVSVLTGLRLWHSQHLQGGLQGFVLNPVFKDNLRIALLGGGK
PWADEGANLGPDRHARDVESLDRYAMERWEVILHFMVGSPSAAVSQDLAQLLIQAGLMKS
ETGEAPCITSAGFQFLLLDTASQLWYFTLQYLKTAQSRGMDLVEILSFLFQLSFSTLGRD
YSVEGMSESLLTFLQHLREFGLVFQRKRKSRRYYPTRLAITLAAGVTANPASGSASSALG
AIPGTGDTGFIVVETNYRIYAYTNSELQIALVALFSEMLYRFPNLVVAQVTRESVQQAIS
NGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELEKDRLQFTEGVLYNQFLSQA
DFEVLRDRAQGLGVLVWQNPAHRVMVVTPHGHSEVKRFWKRQKSHS
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcgcgttcagcttcagtgtaagaacttgcacgagtatctgaaagaactgacc
ccagaaatcctcgacaggctctacaatcacccagcaacatgtctagcagtatacagggaa
cttccaccactggcaaagaattacgtgatgcgcatgctgtttttagaccatccactcccc
caggctgcggttgccctgtgggttaaaaaaggcagtcaaaaagaccatgatcaatgtgtg
tcggtgttaactgggctacggctctggcacagtcagcatcttcaaggtggacttcaaggt
ttcgtgctcaaccccgtgtttaaggacaacctgagaatagcacttctaggcggtggtaaa
ccgtgggcagacgagggtgccaatctgggtcccgatcggcatgcgagggatgtagagagt
ctggaccgctatgctatggagcgctgggaggtcatccttcacttcatggtgggctctcct
agcgcagctgtcagtcaggatctggctcagctcctcatacaggccgggctcatgaagagc
gagactggtgaggctccatgcatcacatcagcagggtttcagttcctgctgctggacacg
gcatctcagttgtggtacttcaccctgcagtacctcaaaacagcacagtcgagaggaatg
gacctggtggagattctttcctttttgttccagctgagtttttccactcttggaagggat
tattctgtggagggcatgagcgagtccctgctcacatttttgcagcatctacgagagttt
ggtctggtttttcaaagaaagaggaagtcaagaaggtactaccctacgagactcgccata
actctcgctgcaggagtcactgcaaacccagcctcgggatctgcctcttctgcactggga
gcaataccaggaacaggagacactggattcatcgttgtagaaactaattatcgcatatat
gcctatacaaactctgaacttcagattgcactggtcgctctgtttagtgagatgttgtat
cggtttcctaacctggtggttgcacaggtcacccgagagtctgtgcagcaggccatcagt
aacggcatcaccgcacagcagattattcacttcttacggacccgagcacacccagttatg
cttaaacagacccccgttctccccccaaccatcacagatcagatcagactgtgggagctt
gagaaagatcgcttgcagtttaccgagggagtgttatacaaccagtttttatcccaggct
gatttcgaagtgttgcgggacagggctcagggtttaggagtgctggtgtggcagaatccc
gctcacagggtcatggtggtgactcctcatggacacagcgaggttaagagattctggaag
agacaaaaaagccattcataa

DBGET integrated database retrieval system