KEGG   Danio rerio (zebrafish): 335008Help
Entry
335008            CDS       T01004                                 

Gene name
pla2g15, lypla3, wu:fa11g04, wu:fc55c03
Definition
phospholipase A2, group XV
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    335008 (pla2g15)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    335008 (pla2g15)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     335008 (pla2g15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Position
25
AA seq 415 aa AA seqDB search
MLPSHRLILASLQLCLLLLVVSFTEGRSLKCPPGKVCSVRPPVVLIPGDLGNQLEAKLDK
PSVVHYICYKKTEDYFTLWLNLELLVPVAIDCWIDNMRLLYNRTNHLSEPPPGVDIRVPG
FGETYSLEYLDPSKRSVGMYFFTIVQSLVDWGYTRNDDVRGAPYDWRKAPNENKEYFLRL
QQMIEEMAHKAGGPVVLIAHSMGNMYTLYFLNHQPQAWKDRYIKAYVSLGPPWAGVAKTL
RVMATGDNNRIPVISPLKIRTQQRTAVSTTWLLPYAHTWPKDMVLVYTPNTTYTVQDYQR
FFKDIDYEDGWAMRQDTEPLVSALQPPGVPVHCLYGTGIPTPQGYNYTNFPDTDPAVING
DGDGTVNLISAIQCKRWKGQQKQAVEWLELPGNEHVAMLLNSTTVDYIKKVLFSP
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcttcccagccatcggttgatcctcgcgtcgctccagctgtgtttgttgttgttggtg
gtgtcttttaccgaaggcagaagtttgaaatgccctcctggaaaagtgtgctcagttcgg
ccgcctgtggttctcattccgggagatcttgggaaccagctggaagcaaaactagacaag
cccagcgttgtgcattatatctgctataagaagaccgaggactacttcacactgtggctc
aacctggagctgctggtgccggtggccattgactgctggattgataacatgaggttactg
tataaccgtaccaatcacctcagtgaacctcctccaggagtggacatcagagttcctggc
ttcggagagacctacagtctggaatacctggatcccagcaaacggagtgtgggcatgtac
ttcttcactatagtgcaatctctggttgactggggttacaccagaaacgatgatgttcga
ggtgctccttatgactggcgtaaagccccaaatgagaataaggagtatttcttgcgtctg
cagcagatgattgaggagatggctcataaggctggaggtcctgtggttctcattgctcac
agtatggggaacatgtacacgctttatttcctcaatcaccaaccgcaggcttggaaggac
cgatacatcaaggcatacgtgtctctggggcctccgtgggctggagtggccaaaactctg
agagttatggcaacaggcgacaacaaccgcattcctgttatcagtcccctaaaaatccgc
acccagcagcgaacggccgtctccaccacctggctcttaccctacgcccacacctggccc
aaagacatggtcctggtttacaccccaaacaccacctacactgtccaggactatcagcgc
ttctttaaagacatcgactacgaggatggctgggccatgaggcaggatactgaaccactg
gttagtgcacttcagcccccgggcgttcctgtccactgtctttacggcacaggtattcca
acacctcagggttacaattacacaaacttcccagatacagacccggctgttattaatgga
gatggagacggaacggtcaacctgataagcgccatacaatgcaaacgctggaaaggccaa
caaaaacaggccgtggagtggctggagctgcctggaaatgagcatgtcgccatgctgttg
aacagcaccacagttgactatatcaaaaaagtgttgttttcaccatga

DBGET integrated database retrieval system