KEGG   Danio rerio (zebrafish): 335008Help
Entry
335008            CDS       T01004                                 

Gene name
pla2g15, lypla3, wu:fa11g04, wu:fc55c03
Definition
phospholipase A2, group XV
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dre00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dre04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Position
25
AA seq 415 aa AA seqDB search
MLPSHRLILASLQLCLLLLVVSFTEGRSLKCPPGKVCSVRPPVVLIPGDLGNQLEAKLDK
PSVVHYICYKKTEDYFTLWLNLELLVPVAIDCWIDNMRLLYNRTNHLSEPPPGVDIRVPG
FGETYSLEYLDPSKRSVGMYFFTIVQSLVDWGYTRNDDVRGAPYDWRKAPNENKEYFLRL
QQMIEEMAHKAGGPVVLIAHSMGNMYTLYFLNHQPQAWKDRYIKAYVSLGPPWAGVAKTL
RVMATGDNNRIPVISPLKIRTQQRTAVSTTWLLPYAHTWPKDMVLVYTPNTTYTVQDYQR
FFKDIDYEDGWAMRQDTEPLVSALQPPGVPVHCLYGTGIPTPQGYNYTNFPDTDPAVING
DGDGTVNLISAIQCKRWKGQQKQAVEWLELPGNEHVAMLLNSTTVDYIKKVLFSP
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcttcccagccatcggttgatcctcgcgtcgctccagctgtgtttgttgttgttggtg
gtgtcttttaccgaaggcagaagtttgaaatgccctcctggaaaagtgtgctcagttcgg
ccgcctgtggttctcattccgggagatcttgggaaccagctggaagcaaaactagacaag
cccagcgttgtgcattatatctgctataagaagaccgaggactacttcacactgtggctc
aacctggagctgctggtgccggtggccattgactgctggattgataacatgaggttactg
tataaccgtaccaatcacctcagtgaacctcctccaggagtggacatcagagttcctggc
ttcggagagacctacagtctggaatacctggatcccagcaaacggagtgtgggcatgtac
ttcttcactatagtgcaatctctggttgactggggttacaccagaaacgatgatgttcga
ggtgctccttatgactggcgtaaagccccaaatgagaataaggagtatttcttgcgtctg
cagcagatgattgaggagatggctcataaggctggaggtcctgtggttctcattgctcac
agtatggggaacatgtacacgctttatttcctcaatcaccaaccgcaggcttggaaggac
cgatacatcaaggcatacgtgtctctggggcctccgtgggctggagtggccaaaactctg
agagttatggcaacaggcgacaacaaccgcattcctgttatcagtcccctaaaaatccgc
acccagcagcgaacggccgtctccaccacctggctcttaccctacgcccacacctggccc
aaagacatggtcctggtttacaccccaaacaccacctacactgtccaggactatcagcgc
ttctttaaagacatcgactacgaggatggctgggccatgaggcaggatactgaaccactg
gttagtgcacttcagcccccgggcgttcctgtccactgtctttacggcacaggtattcca
acacctcagggttacaattacacaaacttcccagatacagacccggctgttattaatgga
gatggagacggaacggtcaacctgataagcgccatacaatgcaaacgctggaaaggccaa
caaaaacaggccgtggagtggctggagctgcctggaaatgagcatgtcgccatgctgttg
aacagcaccacagttgactatatcaaaaaagtgttgttttcaccatga

DBGET integrated database retrieval system