KEGG   Danio rerio (zebrafish): 335153Help
Entry
335153            CDS       T01004                                 

Gene name
setdb2, wu:fk80d09, zgc:77298
Definition
SET domain, bifurcated 2 (EC:2.1.1.43)
Orthology
K11421  
histone-lysine N-methyltransferase SETDB [EC:2.1.1.43]
Organism
dre  Danio rerio (zebrafish)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    335153 (setdb2)
Enzymes [BR:dre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     335153 (setdb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
1
AA seq 551 aa AA seqDB search
METEADTAKTFWSEVDVDGVFDELMEVLRRLRHTLRHNTATDREYVQAMRIVQESKLIRT
ETEDVLLDEDILTVTVSEPQCSPESLQNGIEPEDPQHSTARLYSDVGVVCSHMSSSRPDP
AAPLVFQPHVCSSACVPHLPAHTHHLLGHNPLRAPLLCHFQRVCDDAGVVYKAPCGRSLS
CMQEVLHFLLQTQSVCVLQTDRFSFSTQVCVERQVCAAPLLERDLSRGLEPVPVALVNTV
DGARPREFRYRRERWPHGCFLSAEPLYSVCCDCTDGCTDAHSCACVRRTAGAAYTHQRLT
HTLRTGLFECGPWCGCERSRCENRVVQKGLRVRLQVFRTPEHMWAVRCRDDLDAGTFICI
YAGVVLRLQQSSECPAERSGEPAVSDDEVQLVEEWRIPEETHTHTHTLDSSPPLHVPVIQ
RPAEHSLAQRRDQQQFSISSETEDNRCEQALRKKPRLMESNGLQDSRTHTLTHTHDGVYY
LDASREGNVARFFTHSDDPNLFIQNVFTDTHDPQFPLIAFFTCRPVKAGTELTWSCTNTE
QQKTEEKHCSV
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggagactgaagccgacacagcaaagaccttctggtcagaggtggatgttgatggagtg
tttgatgagctgatggaggttttgagacgcttacgacacacactcagacacaacactgcc
actgacagagagtatgttcaggccatgaggatcgttcaggagtctaagctgataaggact
gaaactgaagatgtgctgttggatgaagatatcctcacagtgacggtgtctgagcctcag
tgttctcctgagagtctgcagaacggcatcgagccggaggatcctcagcacagcacggca
cggctctacagtgatgtgggcgtggtctgcagtcacatgtcctccagcaggcctgatccc
gcagctcctctcgtcttccagccgcacgtctgcagctccgcgtgtgttccgcatctgccc
gcacacacacaccacctgctgggccacaacccgctgcgcgcgccgctgctgtgccacttc
cagcgtgtgtgtgacgacgcaggcgtggtttacaaagcgccgtgtgggcggagcctgagc
tgcatgcaggaggtgctgcacttcctgctgcagacgcagagtgtgtgtgtgctgcagacg
gaccgcttcagcttcagcacgcaggtgtgtgtggagcggcaggtgtgtgcggctccgctg
ctggagcgggacctgagccgcgggctggagccggtgccggtggctctggtgaacactgtg
gacggcgcgaggccgcgggagttccggtaccggagagagcgctggccgcacggctgcttc
ctcagcgcagagccgctctacagtgtgtgctgcgactgcaccgacggctgcactgatgcg
cacagctgcgcgtgtgtgaggaggacagcaggagcagcgtacacacaccagcgcctcaca
cacacactgcgcacagggttgtttgagtgcgggccgtggtgcgggtgtgagcgcagccgt
tgtgagaaccgtgtggtgcagaagggtttgcgtgtgcgtctgcaggtcttccgcacgcca
gagcacatgtgggctgtccgttgccgtgacgacctcgacgccggcaccttcatttgcata
tacgcaggtgtggtcctgcgtctgcagcagagctcggagtgtccagcggagcgcagcggt
gagccggctgtgtctgatgacgaggtgcagctggtggaggagtggaggattcctgaggag
acgcacacacacacacacacactcgacagctcaccgccgctgcacgtaccggtcatacag
aggcctgcagagcacagtctagctcagcgcagggatcagcagcagttcagcatcagcagc
gagacggaggataatcggtgtgagcaggcgttgagaaagaagcccagattaatggagtca
aacggtctgcaggacagcaggacacacactctcacacacacacatgacggagtgtattat
ctggacgcgtcgagggaaggaaacgtggctcgattcttcacccacagcgatgatccaaac
ctcttcatccagaacgtgttcacagacacacacgacccacagttccctctgatcgccttc
ttcacctgcagaccagtgaaagctggaactgaactgacctggagctgcacaaacactgaa
cagcagaagacagaagagaaacactgcagtgtgtag

DBGET integrated database retrieval system