KEGG   Danio rerio (zebrafish): 335736Help
Entry
335736            CDS       T01004                                 

Gene name
usp14, wu:fk63d09, zgc:55949
Definition
ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) (EC:3.4.19.12)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     335736 (usp14)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   335736 (usp14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
2
AA seq 489 aa AA seqDB search
MPVFTVNVKWGKEKFDAVELNTEEPPMVFKAQLFALTGVQPERQKVMVKGGTLKDDEWGN
IKLKNGMTLLMMGSADALPEEPVVRPMFVEDMTEEQLASAMELPCGLTNLGNTCYMNATV
QCLRSVPELKGALRRYSGALRSSGANAPSQYITAALRDLYESMDKTSSSIPPIILLQFLH
MAFPQFAEKGDQGQYLQQDANECWVQVMRVLQQKLEPQEPETPMETDGDSAAAASTKKKS
FIDQYFGVEFETSMKCTEAEDEEPTKGTESQLQLSCFINQEVKYLATGLRLRLQEDITKF
SPSLQRNALYIKSSKISRLPAYHTVQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCTS
ELQEKMVSLRSKFKEMEDKKLEKQQKSEPNKKPGALKETKYEPFSFPDDLGSNNSGYYEL
QAVLTHQGRSSSSGHYVAWVKRKEDEWVKFDDDKVSVVTPEDILKLSGGGDWHIAYVLLY
GPRRLEMLE
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtatttacagtgaatgtgaaatggggaaaggagaagtttgatgcggtggagctg
aacacagaggagccgcccatggtgttcaaagcccagctgtttgctcttacaggagttcag
ccagagagacagaaagtcatggtgaaaggcgggacactgaaggatgatgagtggggcaat
atcaagttgaaaaatggcatgactcttctgatgatgggctctgctgatgctcttcccgag
gagcctgtcgttcgacccatgtttgtagaggacatgacggaggagcagctcgcatctgca
atggagttgccttgtggattgacaaatctgggcaacacgtgctacatgaacgcaacagtg
cagtgtttacgatctgtcccagagctcaaaggcgctctcaggaggtactccggtgccttg
cggtcttctggagctaacgcaccttcccagtacatcacagcagctctgcgtgatttgtat
gagtccatggacaagacctcttcaagcattccacccatcattctcctgcagttcctgcac
atggccttcccacagtttgcagaaaaaggagaccagggccagtacctccaacaggatgcc
aatgagtgctgggtccaggttatgcgggtccttcagcagaaattagaacctcaagaacca
gaaaccccaatggagactgatggcgatagtgcagctgctgcctccacaaaaaagaagagt
ttcattgatcagtattttggggttgagtttgaaacttctatgaaatgtaccgaggcggag
gatgaggaaccgactaaaggcacagagagccagcttcagctcagctgcttcatcaaccag
gaagtcaaatatctcgccactggactgcgattgaggctacaggaggacatcacaaagttc
tctccatctttacagagaaatgccctctacatcaaatcatccaaaatcagccgtctcccg
gcgtaccacacagttcagatggtccggttcttttataaggaaaaagagtctgtgaatgcc
aaagtactaaaggatgtcaagtttcctcttatgctggacgtgtacgagctgtgcacatct
gagctgcaggagaagatggtttctctgaggtccaagtttaaggagatggaggacaagaaa
ctggagaagcaacagaagtctgaaccgaataagaagcctggtgctctaaaggagacaaaa
tatgaacctttcagttttcccgatgacttgggctccaacaacagtggctactatgaactg
caagctgttctgacgcatcagggccgatccagctcatctggccattatgtcgcctgggtt
aaaaggaaagaagacgaatgggtgaagtttgacgatgataaagtcagcgtggtgacgcca
gaggacatcttgaagctgtccggaggtggagactggcatatagcgtacgtcctgctgtac
ggccctcgacgtctggaaatgctcgagtaa

DBGET integrated database retrieval system