KEGG   Danio rerio (zebrafish): 336069Help
Entry
336069            CDS       T01004                                 

Gene name
gria4b
Definition
(RefSeq) glutamate receptor, ionotropic, AMPA 4b precursor
  KO
K05200  
glutamate receptor 4
Organism
dre  Danio rerio (zebrafish)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    336069 (gria4b)
Ion channels [BR:dre04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   336069 (gria4b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
21
AA seq 904 aa AA seqDB search
MRISCNQLLLLFSCVWGLTMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCGALHISLITP
SFPTEGESQFVLQLRPSIRGALLSLLDHYDWNRFVFLYDTDRGYSILQAIMEKAGQNGWQ
VSAICVENFNDASYRQLLEDLDRRQEKTFVIDLEAERLNNMLEQIVSVGKHVKGYHYIMA
NLGFKDINLERFMHGGANVTGFQLVDFSNPMVIKLMQRWNKLDQREYPGSDAPPKYTSAL
TYDGVMVMAEAFRNLRRQKVDISRRGIAGDCLANPAAPWNQGIDMERTLKQVHLQGLTGN
VQFDHYGRRVNYTMDVFELKSNGPRRIGYWNDADKLVLTQDHALLPNETSGMENRTVIVT
TIMEGPYVMLKKNWEMYEGNEQYEGYCVDLASEIAKHIGFKYKISIVPDGKYGARDPETK
IWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGTDGLPSDQPPNEFGIFNSL
WFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAE
DLAKQTDIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRKSK
GKYAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGVATPKGSQLRSAVNLAVLKLNEQG
LLDKLKNKWWYDKGECGSGGGGEKDKSSQALSLSNVAGVFYILVGGLGLAMLVALIEFCY
KSRNEAKRMKLTFTEAMRNKARLSITGSVGENGRVLTPDCPKAVHSGPSLRQSSGLALVS
SDLP
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgaggatttcttgtaatcagcttttattgctattctcttgcgtttggggactcactatg
ggtgcttttccgagcagcgttcaaatcggcggcctgttcatcaggaacacagatcaggag
tacacggcctttcggttggccatttttcttcacaacacaagccctaatgcatccgaagcc
ccttttaacttggtaccccatgtggacaacattgagacggccaacagcttcgccgtgacc
aatgccttctgttcccagtactcacggggcgtcttcgccattttcggcctgtacgacaag
aggtcggttcacacgctaacatcattctgcggcgcgctgcacatctccctcatcacaccc
agtttccccaccgagggcgagagccagttcgtcttacagctgcggccctccatacgaggg
gccctgctcagcctgctggaccactatgactggaatcgctttgtctttctctacgacacc
gacagggggtattccatactgcaggccatcatggaaaaggcaggccagaatggttggcag
gtcagcgccatatgtgtggagaactttaatgatgccagttaccggcaacttctggaagac
ctggaccgaaggcaggaaaagacgtttgtcatagacctggaggcagagagactgaacaac
atgctggaacagattgtgagtgtcggcaagcatgtcaaaggctaccattacatcatggca
aatttgggttttaaggacatcaatctggagcgtttcatgcatgggggagccaatgtgaca
ggctttcagctggtggacttcagcaatcccatggttattaaactcatgcagcgctggaac
aagctggaccagcgcgagtaccccggctctgacgcacctcccaagtacacttcagctctg
acgtatgacggggtcatggtgatggcagaggccttcaggaacctccgcaggcagaaggtg
gacatctctcgcagaggcatcgctggagactgtctggccaaccccgctgccccctggaac
cagggcatcgacatggagcgcacgctcaaacaggtgcacctccaaggattaacaggaaat
gtccaatttgaccactacggccgcagagtcaactacactatggatgtttttgaattaaaa
agtaacggccccagaaggatcggatactggaacgatgctgataaactggttctgacccag
gatcacgccttgcttcccaacgaaacgtctggcatggagaatcgaaccgtaattgtgacg
actatcatggaagggccgtatgtaatgctgaagaaaaactgggaaatgtacgaggggaat
gagcaatatgagggatactgtgtggatttggcatctgaaattgccaaacacatcggtttc
aagtataagatctccatcgtgcctgatggaaagtacggagctcgagacccagagactaag
atctggaacgggatggtcggggagctggtgtacgggaaagcggaaatcgctgtggcccca
ttgactataactttggtccgggaggaggttattgacttctcgaaacccttcatgagcttg
ggcatctccatcatgatcaagaagcctcaaaagtccaagccgggtgtcttctccttcctg
gacccactggcctacgagatctggatgtgcatcgtgttcgcctatataggcgtgagcgtg
gtgctcttcctggtcagccgcttcagcccgtatgagtggcacaccgaggagcccgaagag
ggcactgacggtctgcccagcgaccagccccccaatgagttcgggatcttcaacagtctc
tggttctcactcggtgccttcatgcagcaggggtgcgacatctcgcccaggtctctatct
ggccgtatcgtgggtggagtgtggtggttcttcaccctcatcatcatctcctcctacact
gcaaacctggcagctttcctgactgtggagaggatggtgtcgcccatcgaaagtgctgag
gatctggccaagcagacagacatcgcgtacggcactcttgactcaggctccaccaaagag
ttcttcaggaggtcgaagatcgccgtgtatgagaagatgtggagctacatgaagtcagca
gagcccacagtgttcaccaaaaccactgcagagggagtcgcacgggtcagaaaatccaaa
gggaaatacgccttcctcctggagtccaccatgaatgaatacacggagcagcgcaaacca
tgtgacaccatgaaagtcggaggaaacctggactccaaaggctacggggtggcgacgcca
aagggctcacagttaagaagtgcagttaacctggcagttttaaaactgaatgaacaaggc
ctgttggacaaattgaaaaacaagtggtggtacgacaaaggagagtgtggcagcggagga
ggtggtgagaaggacaagagctcacaggccctcagcctcagtaatgtggctggggtcttc
tacattctggtcgggggcctgggcctggccatgctggtggccctcatcgagttctgctac
aagtcccgaaacgaggccaagagaatgaagctcaccttcaccgaagccatgcggaacaag
gcgcgcctgtccattacggggagcgtgggtgagaacggacgcgtcctgactcctgattgc
ccaaaggctgttcattccggcccctcgctgcggcagagctccggactggctctggtgtca
tccgacttaccgtga

DBGET integrated database retrieval system