KEGG   Danio rerio (zebrafish): 337131Help
Entry
337131            CDS       T01004                                 

Gene name
c1galt1b, c1galt1, fa98f05, wu:fa98f05, zgc:66485
Definition
core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1b (EC:2.4.1.122)
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
dre  Danio rerio (zebrafish)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    337131 (c1galt1b)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     337131 (c1galt1b)
Glycosyltransferases [BR:dre01003]
 Glycan extension
  Type 3 chain
   337131 (c1galt1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
6
AA seq 374 aa AA seqDB search
MKALGARSAFYVGFLVGTCSLYLLLRQAGFTRDSGSREPGTHDKTLLEMLEEENKNWKKE
RSALFNLNHPHHTGEDGALADSLYKRVRILCWVMTGPDNLEKKARHVKATWSRHCNIVVF
ISSVDNPDFPTVGLNTKEGRDQLYWKTIRAFHYVMEKHSDEADWFLKADDDTYVIVDNLR
WILARHSPEDPVYFGRRFKPYVKQGYMSGGAGYVLSKEALRRFVEGFRTKVCTHTTSVED
LAMGQCMEKIGVKAGDSRDTMQRETFHPFVPESHLTGTFPKTFWYWNYCYYPIVQGPQCC
SDLAVSFHYVDASHMYLLEYYTYHLRAFGYKYRYQPPEPNVKAPEKVETRVLEQKDKVEA
QEEENQSPELNDKL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcggcgcgcgctccgcgttctacgtgggctttctggtgggcacgtgcagc
ttatacctgctcctgcgtcaggctgggttcacccgggactcgggctctcgtgagcccggg
acccacgataaaaccctgctggaaatgcttgaagaagaaaacaagaactggaagaaggag
aggtcggctcttttcaacctcaatcatccgcaccatacaggtgaggatggcgcactggct
gactctctttataagcgtgtacgcattctctgttgggttatgactggccctgataacctg
gaaaagaaagctcggcatgtgaaagccacatggagtcgtcactgcaacattgtggtcttt
ataagctctgtggacaatccagattttcccacagttggcctgaacactaaagaaggtcgg
gatcagctatactggaaaaccatccgcgctttccactatgtcatggagaagcacagcgat
gaggcagactggtttctcaaagcagatgatgacacttatgtgatcgttgacaacctgcgc
tggattctggctcgccattctccagaggacccagtgtactttggccggcgttttaagcca
tatgtaaaacagggctacatgagtggaggtgctggctatgtgctcagcaaagaggctctg
aggaggtttgtggagggctttcgcaccaaggtgtgcactcacactacctcagtggaggac
cttgctatgggtcagtgtatggagaagataggtgtcaaggcaggagactccagagacacc
atgcaaagagagacattccatcctttcgtacccgagtcccatctcactggcacatttccc
aaaactttctggtactggaactactgttattaccccattgtacagggcccacagtgttgc
tcagacctggctgtttctttccactatgtggatgcgtcgcacatgtacctgctggaatac
tacacttaccacttgcgtgcctttggctacaaatatcgctatcagccccctgaacccaat
gttaaagccccagagaaagtagaaactcgagtcttggagcaaaaggacaaggttgaagca
caggaagaggaaaaccaatcccctgaacttaacgacaagttatag

DBGET integrated database retrieval system