KEGG   Danio rerio (zebrafish): 337131Help
Entry
337131            CDS       T01004                                 

Gene name
c1galt1b
Definition
(RefSeq) glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-B
  KO
K00731  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    337131 (c1galt1b)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  N-acetylgalactosaminide beta-1,3-galactosyltransferase
     337131 (c1galt1b)
Glycosyltransferases [BR:dre01003]
 Glycan extension
  Type 3 chain
   337131 (c1galt1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 337131
NCBI-ProteinID: NP_956345
ZFIN: ZDB-GENE-030131-9075
Ensembl: ENSDARG00000055561
Vega: OTTDARG00000019887
UniProt: Q7SYI5
Position
6
AA seq 374 aa AA seqDB search
MKALGARSAFYVGFLVGTCSLYLLLRQAGFTRDSGSREPGTHDKTLLEMLEEENKNWKKE
RSALFNLNHPHHTGEDGALADSLYKRVRILCWVMTGPDNLEKKARHVKATWSRHCNIVVF
ISSVDNPDFPTVGLNTKEGRDQLYWKTIRAFHYVMEKHSDEADWFLKADDDTYVIVDNLR
WILARHSPEDPVYFGRRFKPYVKQGYMSGGAGYVLSKEALRRFVEGFRTKVCTHTTSVED
LAMGQCMEKIGVKAGDSRDTMQRETFHPFVPESHLTGTFPKTFWYWNYCYYPIVQGPQCC
SDLAVSFHYVDASHMYLLEYYTYHLRAFGYKYRYQPPEPNVKAPEKVETRVLEQKDKVEA
QEEENQSPELNDKL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcggcgcgcgctccgcgttctacgtgggctttctggtgggcacgtgcagc
ttatacctgctcctgcgtcaggctgggttcacccgggactcgggctctcgtgagcccggg
acccacgataaaaccctgctggaaatgcttgaagaagaaaacaagaactggaagaaggag
aggtcggctcttttcaacctcaatcatccgcaccatacaggtgaggatggcgcactggct
gactctctttataagcgtgtacgcattctctgttgggttatgactggccctgataacctg
gaaaagaaagctcggcatgtgaaagccacatggagtcgtcactgcaacattgtggtcttt
ataagctctgtggacaatccagattttcccacagttggcctgaacactaaagaaggtcgg
gatcagctatactggaaaaccatccgcgctttccactatgtcatggagaagcacagcgat
gaggcagactggtttctcaaagcagatgatgacacttatgtgatcgttgacaacctgcgc
tggattctggctcgccattctccagaggacccagtgtactttggccggcgttttaagcca
tatgtaaaacagggctacatgagtggaggtgctggctatgtgctcagcaaagaggctctg
aggaggtttgtggagggctttcgcaccaaggtgtgcactcacactacctcagtggaggac
cttgctatgggtcagtgtatggagaagataggtgtcaaggcaggagactccagagacacc
atgcaaagagagacattccatcctttcgtacccgagtcccatctcactggcacatttccc
aaaactttctggtactggaactactgttattaccccattgtacagggcccacagtgttgc
tcagacctggctgtttctttccactatgtggatgcgtcgcacatgtacctgctggaatac
tacacttaccacttgcgtgcctttggctacaaatatcgctatcagccccctgaacccaat
gttaaagccccagagaaagtagaaactcgagtcttggagcaaaaggacaaggttgaagca
caggaagaggaaaaccaatcccctgaacttaacgacaagttatag

DBGET integrated database retrieval system