KEGG   Danio rerio (zebrafish): 337489Help
Entry
337489            CDS       T01004                                 

Gene name
plcd1b, Plcd1, fj78d10, wu:fj78d10, zgc:55868
Definition
(RefSeq) phospholipase C, delta 1b (EC:3.1.4.11)
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    337489 (plcd1b)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    337489 (plcd1b)
   04070 Phosphatidylinositol signaling system
    337489 (plcd1b)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    337489 (plcd1b)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     337489 (plcd1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
2
AA seq 749 aa AA seqDB search
MDSNGVTDKKVLEGDRDLQFLMNGGDLLKVRSESWKKTRYFKLQEDCKTMWHESKKTLKT
KQTFSIEDIEEVRTGRQTDSLRKYTEETLEGRAFSILFKGRQKSLDLIASTEEEAKKWVS
GLEKVISSLNNLSSQKKTEHWIYSSLRKADKNLDNKMSLKEVKSFLKDINVEVHEDYAEM
LFKECDKSNGGFLEGNEIEHFYKILTKREEIDVIYGEYAKTDGLMSANDLLNFLLTEQRE
EVSQNDALQLIEKYELDENAKAKQQMTQDGFLMYLHQPEGLIFNQAHKSVYHDMNQPLSH
YFISSSHNTYLMEDQLKGPSSTEAYIKALLKGCRCVELDCWDGSDGEPVIYHGYTLTSKI
LFKDVIKAIKEYAFKTSEYPVILSLENHCGVEQQKIMAQHLTSILGSALVTKPLGDQMPT
CLPAPEELKGRFIVKGKRLDKLENAFSDESKMADEESVSEEEDDEGDEENNEKKSGSLKL
AKELSDIVIYCKSVPFHGLEDSREKHSFYEMASFKEGKALKLAEESATEYIRHNTDKLSR
IYPGGMRTDSSNYNPVPMWNAGCQIVALNFQTPCLEMDLNQGLFYQNGRSGYILKPSYLR
ERDTEFDPITPTKGPWLKRKTLHVMVISAQQLPKVGKRESAIVDPIVKVQVYGVPADTAA
VETSYIKNNGFNPMWNENFQLEVCVPDLALVRFLIEDYDSTSDNEFIGQYTLPFNSLRNG
YHHVPLLTQDGNLLSSAGLFVHIMVVDTE
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggactcaaacggcgttactgataaaaaagttttggagggcgaccgtgacctgcagttc
ctgatgaacggcggagaccttctgaaggtgcgttctgagtcgtggaaaaagacgcgctac
ttcaagctgcaggaggactgcaagaccatgtggcacgaatccaaaaagacactaaagacc
aaacagacattctctattgaggacattgaggaagtccgaacaggtcgacaaacagacagt
ctgaggaaatacacagaggagacattggagggtcgagcgttctccatcttgtttaagggt
cgtcagaaaagcctggacctaatcgccagcactgaggaagaagccaagaaatgggtcagc
ggtttggagaaagtcatctcaagcttgaacaacctcagttcacagaagaagacggagcac
tggatctacagctccttgcggaaagcagacaaaaacctggacaacaagatgagtctgaaa
gaggtcaagagctttctgaaagacatcaacgttgaagtgcacgaagactacgctgaaatg
ctctttaaggaatgcgacaaatcgaacggtggattcctggagggaaacgagattgagcat
ttctacaaaatcctgacgaaaagagaggagattgatgtcatttatggggagtatgcaaag
acagatggtctcatgagcgcaaatgacctgctgaactttctgctgactgagcagagagaa
gaggtgtcccaaaatgatgcccttcaactcattgagaaatatgaactcgatgaaaacgcc
aaagccaaacagcaaatgacccaggatggcttcctgatgtacttgcaccagccggagggg
ctgatctttaaccaggctcataaaagtgtttaccatgacatgaaccagcctctcagccat
tacttcatctcctcctctcacaacacatacctgatggaggaccagctcaaaggacccagc
agcactgaggcctacataaaagctcttctgaagggctgccgctgcgtggagctggactgc
tgggatggatcagacggagagccggtcatttaccatggatatactctcacttcaaaaatc
ctcttcaaagatgtgattaaagccattaaagaatatgccttcaagacgtccgagtacccg
gtgattctgtctctggagaaccactgcggtgtggagcagcagaagatcatggctcagcat
ctgacctccattctgggcagcgcactggtcaccaaaccccttggagatcagatgcccaca
tgcctgcctgcaccagaggaactcaaaggccggttcattgtcaaagggaagagactagac
aaactggaaaacgcattttctgatgagtccaagatggcagatgaagaaagtgtgtcagag
gaagaagacgatgaaggtgacgaagaaaacaacgaaaagaagtctggctcgctgaagctg
gcgaaggagctttctgacattgtgatctactgcaagagtgtgcccttccatgggcttgag
gattcccgggaaaagcattctttttatgagatggcctccttcaaagaggggaaagctttg
aaactagcggaggagtcagcaactgaatatatccgtcacaacaccgacaagctcagtagg
atttacccaggaggaatgaggacggactcctccaactataaccctgtgcccatgtggaat
gcaggctgtcagatagtggctctgaacttccagactccgtgtttagagatggacctgaac
caggggctcttttatcaaaatggacgaagcggttacatcctaaaaccttcttacctgcga
gagcgcgacactgagtttgaccccatcacccccaccaagggcccgtggctgaagagaaag
actcttcatgtgatggtgatctcagcccagcagttgcccaaagtgggtaagagagagtcc
gccattgtggaccctattgtgaaagtgcaggtgtacggtgtgcccgctgacacagcagct
gtggaaacatcctacattaagaacaatggttttaaccccatgtggaatgaaaacttccag
ttggaggtgtgtgtgccagatctggccttggtgcgtttcttgattgaggactacgactcc
acatcagacaacgagtttatcggccagtacacactgcccttcaacagcttgaggaacgga
tatcatcacgtgcctctgctcactcaggacggaaacctgctttcctcggccgggctgttc
gttcacatcatggttgtggatacagaataa

DBGET integrated database retrieval system