KEGG   Danio rerio (zebrafish): 337767Help
Entry
337767            CDS       T01004                                 

Gene name
lamb2, si:dkey-32e6.2
Definition
laminin, beta 2 (laminin S)
Orthology
K06243  
laminin, beta 2
Organism
dre  Danio rerio (zebrafish)
Pathway
Focal adhesion
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:dre04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:dre04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
23
AA seq 1782 aa AA seqDB search
MRALLLLSICVLSAVSAQEPDAAHGCTHGSCYPATGDLLVGREANLKASSTCGLRRREPY
CIVSHLQEEKKCFQCDSRRPYDPQSNPVSHRIENVITTFKPHRKKSWWQSENGKSDVYLQ
LDLEAEFHFTHLIMTFKTFRPAAMLIERSADFGRSWQVYRYFANDCESIFPGISQDSLRK
VDDVICESRYSDIEPSTEGEVIFRVLDPAIRIEDPYSPRIQNQLKITNLRLNLTKLHTLG
DNLLDSRPEIKEKYYYAMYELVVRGNCFCYGHASECAPIEGIRDDIEGMVHGRCVCKHNT
KGLNCEQCDDFYNDLPWRPAEGRNTNACKKCNCNGHSNQCHFDMAVYLATGNISGGVCDN
CLHNTMGSNCESCKPFYYQDPTRDIRDPGVCVACDCDPDGSKNGGVCDGHDDPSLGMIAG
QCRCKDNVEGSRCDKCKPGFFGLSASDPRGCQPCKCDPRGTVSGSSQCDPVSGDCFCKRL
VTGHSCNQCLPEHWALSHDTSGCRGCDCDVGGATENQCSMETGQCQCRSHMIGRQCNQVE
SGYFFMALDHYIYEAETAKLGQGSVFEEREYQPGRPISWTGTGFARAPEGGTLEFAINNI
PYSMEYDVLIRYELQMPRDWEEVRVVVIRPGPIPTSSPCGNTIPADDLLTVSLSSGARFV
VLPQPVCLESGVSYKLRVELIRYADRNSIITSTNAFVLVDSIALLPRYLSLEMFTAGDPA
SVARKQSFERYRCHETAKSVSRPQMSEVCAKLITSMSALINDGALACECDPQGSLSSECD
VRGGQCRCRPNISGRRCEKCAPGAYGFGPSGCKLCECSLEGSQSRFCDLYSGQCPCRPGA
YGQRCDGCQAGHWGFPNCRPCQCNGHADECHQRTGACLNCRSNTAGDKCERCANGYYGNP
VLGLGSQCRPCPCPEGPNSGRHFAASCYQDNRSQQVVCNCNQGYTGPRCDECAPGYFGDP
SKPGGQCQPCRCSNNIDLSDPESCDKRTGQCLKCLYNTEGPDCSVCRSGYYGDASRRNCR
KCTCNFLGTERSQCLSRDDCVCQRATGQCQCLPNVIGQTCDHCAPNSWNLASGQGCEPCA
CDPNNAYTSACNEFTGQCQCRVGFGGKTCTDCQENHWGDPRVLCRACDCDPRGIESSQCN
RMTGHCVCQQGVSGVRCDQCARGFSGTFPDCKPCHQCFGDWDRIVQDLATRTKALTDRAK
ELQTTGLTRAFERRFKELEDMLAQARDIVNARNATAEAVTTLMGMIEVLRAQIGETTDTL
NQQEGDLTAVQDSNYEASNALSTLEREAKELNLNADQLNRQLDILKNSNFLGAYDSIRAS
YNKSRDAEHRSNRSTTDTPSTVSQSADTRKKTERLIGQKRDDFNRKNAANKRTLTDLNAK
VQNLDLKKINEKVCGAPGDAQCVDSPCGGAGCRDDEGKRRCGGLNCNGAVAVADTALDRS
KHAEKELDKAMGVVEELFKQVADAKTKAQEAKDRAQAALEKASDTKNKVDHSNNDLRDLI
KQIRQFLMQEGADPDSIEAVANRVLELSIPASPKQIRHLADEIKDRVKSLSNVDAILEQT
QNDVRKAEQLLLDAKKARNKAEGVKNTAESVKKALNDASRAQAAAEKAIQKAKNDIGLTQ
NQLAQIQSETSASERDLNDAVDRLGDLERQIEALKTKRANNSLDAARAEETATMARDKAN
EAKEILDGELSDKYRTVQGLMDNKAKTMQDAKHKAEQLRDEAKGLLKDAQDKLQRLAELE
KDYEENQKVLEGKARQLDGLEDKMKAILNAINRQIQIYNTCQ
NT seq 5349 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgcttctgttgctgtccatctgtgtcctgtcagcggtcagtgcacaggagcct
gatgctgctcacggctgcactcatggaagctgctatcctgcaaccggtgacctcttggtg
ggtcgagaagccaacctgaaagcatcatccacctgtggcctgcggaggagagaaccctac
tgcattgtcagccatctgcaggaggagaagaagtgtttccagtgtgattcacggcggcct
tatgatcctcagtccaaccccgtaagccaccgcatcgagaacgtcatcaccaccttcaaa
ccacatcgcaagaagtcctggtggcagtcggaaaacgggaagtctgatgtttaccttcag
ctggatctggaggctgagtttcacttcactcatctcatcatgacttttaagactttccgt
ccagcagccatgttgattgagagatctgcagatttcggccgaagctggcaggtgtatcgc
tactttgctaacgactgcgagtccatctttccaggaatttcccaagattctcttcgaaag
gttgatgatgtcatctgcgagtccagatattctgatatcgagccgtcgacagaaggagag
gtgatttttcgtgttcttgaccctgctatcaggatcgaggacccttacagcccaagaatt
cagaaccagctgaagatcacaaatcttcgcctgaatcttaccaagctgcacactctgggt
gacaatctgctggactcacggcctgagatcaaggagaaatactactatgccatgtatgag
ctggtcgtcaggggcaactgcttctgctatggccacgcctctgagtgtgcgccaattgag
ggcatcagggatgacattgaaggcatggttcacgggaggtgtgtgtgcaaacacaacact
aaaggactgaactgtgaacagtgtgacgacttctacaatgatctgccctggagaccagca
gaaggccggaacactaatgcctgcaagaaatgcaactgtaatggtcactccaaccagtgt
cattttgacatggcggtgtatttggcaacggggaacatcagtggaggtgtgtgtgacaac
tgccttcacaacaccatgggcagcaactgtgagagctgtaaacctttctactaccaggat
ccaactagagatattagagaccctggagtctgtgtagcttgcgattgtgacccagatggc
tctaagaacggtggtgtttgtgacggccatgatgacccttctctgggcatgattgctgga
cagtgccgctgtaaagacaatgttgaaggttcacgctgtgataaatgcaagcctggtttc
tttggcctgagtgctagtgatccacgtggttgtcaaccatgtaaatgtgaccccaggggt
acagtttccggcagctcccaatgtgaccctgtgagcggagactgcttctgtaaacgcctg
gtcactggacacagctgcaaccaatgtctgcctgagcactgggccttgagtcatgatacc
agtggctgcagagggtgtgactgtgatgtgggcggagctacagaaaaccaatgctcaatg
gaaacagggcagtgtcagtgtcgaagccacatgattggtcgccagtgcaaccaggtggag
tctgggtactttttcatggcacttgaccactacatctatgaagctgaaactgccaaactg
ggtcaaggctctgtttttgaggagagagagtaccagccgggtcgccccatctcatggaca
ggcacaggctttgcacgagctcctgagggcgggacgctggaattcgcaattaacaacatc
ccatactctatggaatatgacgtcctgattcgctatgagcttcagatgccacgtgactgg
gaagaggtgcgtgttgtagtgattagacctggtcctatacctaccagcagtccatgtgga
aacaccatccctgcagatgatctgctaacggtgtcgctttcctctggtgccaggtttgtg
gttctgcctcagccagtgtgtttggagagtggtgtgagttacaaactgcgcgtggagctc
atccgttacgctgacaggaacagcatcattacctccaccaatgcctttgtgcttgttgac
tctatcgcacttctcccccgttacttgtctctggagatgtttactgcaggagacccggcc
tctgtcgcacgcaagcagagttttgagcgttaccgctgccacgaaactgccaagagtgtg
tcccgtccgcagatgagtgaagtgtgtgccaaactcatcaccagcatgtctgccctcatt
aatgacggcgcgctggcgtgtgagtgtgatcctcaaggttcgctcagctctgagtgtgat
gtccgtggcggtcagtgccgctgcaggcccaacatatctggccggcgctgtgagaaatgt
gcaccaggagcttacggctttggcccatctggatgcaaactttgtgaatgcagtttagag
ggctctcagagccggttctgtgacctgtactcaggacagtgtccatgccgacctggagca
tatggtcagcgctgtgatggttgtcaggcaggacactggggtttcccaaactgcaggcca
tgtcaatgtaacggccatgctgacgagtgccatcagaggactggagcctgtctcaactgc
agaagtaatactgcaggagacaaatgtgaaaggtgtgctaatggctactatggtaaccca
gtccttggtttagggagtcagtgtcggccctgcccctgtcctgagggccccaacagcgga
cgccactttgctgcctcttgttaccaagacaaccgaagccaacaggtggtctgcaactgc
aaccagggttacacaggtccacgttgtgatgaatgtgctcctggctattttggtgacccg
tctaagcccggtgggcagtgccagccatgtcgttgcagtaataacatcgacctgtcagat
cctgagtcttgtgacaagcgcactggccagtgtctgaagtgcctgtacaacactgaaggg
ccagactgtagtgtgtgcaggagcggatactatggagacgcttctcgacgcaactgccgg
aagtgcacctgtaacttcctgggcacagagcgcagtcagtgtctgtctcgagatgactgt
gtgtgtcagcgtgccactggtcagtgtcagtgtctgcctaatgttattggacaaacctgt
gatcactgcgctccaaactcctggaacctggccagcgggcaaggctgtgagccctgcgca
tgtgaccctaacaatgcctacacatctgcctgtaatgagtttacaggccagtgccagtgc
cgtgttgggtttggaggaaagacctgtacagactgtcaggagaaccactggggtgaccca
agagtgctatgccgagcatgtgactgtgacccccgtggcatcgagtcatcccaatgcaac
cgtatgacgggtcactgcgtgtgccagcagggtgtttctggtgtccgctgtgatcagtgt
gcccgtggcttctccgggaccttccctgactgtaagccttgccaccagtgttttggggac
tgggaccgtatcgttcaggatttggccaccagaactaaagccctcacagatcgagccaag
gagcttcagaccaccggcctgactcgagcattcgagagacgctttaaggagctggaagac
atgctggcacaggcacgggacattgttaatgcccgtaatgccactgctgaggctgtgacc
accctgatgggcatgattgaggttctcagagctcagattggcgagaccacagacacactg
aaccagcaggagggagacctgaccgccgtgcaggacagtaactatgaagccagtaatgct
ttaagcacactggagagagaagcaaaagagctcaacctgaacgcagatcagcttaaccgt
cagcttgacatcctcaagaactccaacttcttgggtgcatatgacagcatccgggcctcg
tataataagtcacgtgacgcagagcaccgatcaaacagatctaccactgacactcccagc
acagtcagccaatcagcagacacccgcaagaaaacagagcggctgattggccaaaagaga
gatgattttaaccgcaagaacgctgctaacaagcgtacactcactgacttaaatgcaaaa
gttcagaatctggacttaaagaaaatcaacgaaaaggtgtgtggagctccaggtgatgct
cagtgtgttgacagtccttgtggtggtgctggttgtcgtgatgatgaaggcaagcgtcga
tgtggaggcctgaactgtaatggagctgttgcagtggcggacactgctctggatagatcc
aaacatgcagaaaaagagctggataaagcaatgggggtagtggaggagctttttaagcag
gtggcggatgctaagaccaaggcacaggaagcgaaagacagagctcaggcagctctggaa
aaagctagcgataccaagaacaaagtggatcattctaacaatgatctaagggaccttatc
aaacaaatacgccaattcctcatgcaggagggtgcagatccggacagcattgaggcggtg
gccaatcgtgtgctggagctctcaatccctgcctctcccaagcagatccgacacctagca
gacgagattaaagaccgtgtcaagagtctgtctaatgtggatgccattctggagcaaaca
caaaatgacgtccgcaaagcagagcaactgttgctggatgccaagaaagctaggaataag
gcagagggggtgaagaacacagctgagagtgtgaaaaaggccctgaatgatgccagcaga
gcccaggctgcagcagagaaagccatccagaaagctaagaatgacattggcttaactcag
aaccagctggcacagatccagtcagagacctccgctagtgagagagatcttaatgatgca
gtggacagactgggagacctggagcgccagatcgaggcattaaagaccaaacgtgccaac
aacagcctggatgctgcacgggcagaggagacggccaccatggcacgggacaaagccaac
gaagccaaagagatcctggatggtgagctgtccgataagtaccgtactgttcagggtctg
atggacaataaggcgaaaaccatgcaggacgccaagcacaaagcagagcaattgagagat
gaagccaaggggctgctgaaagatgcacaggataaactgcagaggctggcagagcttgaa
aaggactatgaagaaaaccagaaggtattggaaggcaaagccaggcagctggatggcctg
gaagataaaatgaaggcgatcctgaacgccatcaacaggcagattcagatctacaacacc
tgtcaataa

DBGET integrated database retrieval system