KEGG   Danio rerio (zebrafish): 352926Help
Entry
352926            CDS       T01004                                 

Gene name
gpx1a
Definition
(RefSeq) glutathione peroxidase 1a
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00480  Glutathione metabolism
dre00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    352926 (gpx1a)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    352926 (gpx1a)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     352926 (gpx1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 352926
NCBI-ProteinID: NP_001007282
ZFIN: ZDB-GENE-030410-1
Ensembl: ENSDARG00000018146
Vega: OTTDARG00000027688
UniProt: Q5XJ48
Position
11
AA seq 191 aa AA seqDB search
MAGTMKKFYDLSAKLLSGDLLNFSSLKGKVVLIENVASLUGTTVRDYTQMNELHSRYADQ
GLVVLGAPCNQFGHQENCKNEEILQSLKYVRPGNGFEPKFQILEKLEVNGENAHPLFAFL
KEKLPQPSDDPVSLMGDPKFIIWSPVCRNDISWNFEKFLIGPDGEPFKRYSRRFLTIDID
ADIKELLKRTK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaccatgaagaagttttacgacctgtccgcgaaactattgtcaggagatctc
ctgaatttttcctctctcaaaggaaaggttgtgctgattgaaaatgtggcgtcgctttga
ggcacaacagtcagggattacacccagatgaacgagctccacagccggtacgccgaccag
gggctggtggttctgggcgctccctgcaaccagttcgggcaccaggagaactgcaagaat
gaagaaatcctgcagtctctgaaatacgtccgtcctggaaatggcttcgagcccaaattc
caaattctggagaagctggaagtgaatggtgaaaacgcccaccctctgtttgcgttcctg
aaggagaagcttcctcagcccagtgacgaccctgtgtcccttatgggagaccctaaattt
atcatctggagccccgtgtgcaggaatgacatctcctggaactttgaaaagttcctcatc
gggccggacggggaaccattcaagaggtacagcagaaggttcctcaccatcgacattgat
gctgatattaaagagcttctgaagagaaccaagtaa

DBGET integrated database retrieval system