KEGG   Danio rerio (zebrafish): 352927Help
Entry
352927            CDS       T01004                                 

Gene name
clock3, zfClock3
Definition
clock homolog 3 (mouse)
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Pathway
Herpes simplex infection
Class
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:dre05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
1
AA seq 813 aa AA seqDB search
MSSRDRDDGSIFDGLMEEDEKDKAKRVSRNKSEKKRRDQFNVLIKELGTMLPGNTRKMDK
STILQKSIDYLRKNKENAAQSESSDIKQDWKPPFLSNEEFSQLMLEALDGFFLVMLTDGY
IIYISESVTSLLEHLPSDLMDQNLLNFLPVVDHGEVYKALSSQPDIENLNSDYLKSKNQM
EFCCHMLRGSVDPKKPPVYEYVKFIGNFKSLVNMPQKTRNGLEGILQHSLQPAFDDQLCF
IATVRLAKPQFIKEMCMVEEPNEEFTSRHSLEWKFLLLDHRAPPIIGYMPFEVLGTSGYD
YYHVDDLHSLAKCHEHLMQFGKGKSCYYRFLTKGQQWIWLQTNYYITYHQWNSRPEFIVC
THTVVSYAEVRAERRREMGIEESPPELTADKKSGSETQLNNSLKKVLERFSDSRSPSTSS
RSSHKSSHTAISDNTCTSTPSKLHMDVSSSPRPATVDMISQRRSSVSTQSMSSQNTTQTD
SPVQISQQTQHQQPQQPQQVQPNALFSAQLNAMQHLKEQLEQRTRMIEANIQKQQEELRQ
IHEQLQRVQGPQMILQQPAQGGGPSVQLPQVGGAQNNILGIGTQASVVAIQGQNVTSTAH
SGSAPQQQTLPQQQTPRSLQQNLQSSSVTQCGPVYNTMMISQPANANVVQIPSNLAPKIS
QANAINRFPAGQQLVTKIVTAPMACGAVMVPTSMFMGQVVTAYSPFTQQQGQTQTITLQT
QPTVPADQQTQAATLQSQQQGATQQSTKQQQPFLQSTRLLHGNQPTQLILQAFPIQQQST
FTPSQQQQQQQVTETTHSETPETNGLLSSDGQR
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgagctccagagacagggatgatggcagtatttttgatgggctcatggaggaagatgag
aaagataaggcgaaacgagtttcgaggaataagtcggagaagaaaaggcgggaccagttc
aacgtcctcattaaagaacttgggaccatgctgcctggaaacacacgaaagatggacaag
tctacgattttgcaaaaaagcatagactacctgcgcaagaacaaagaaaacgctgcacaa
tcggaatcgagtgacatcaagcaggattggaaacctccgtttctcagcaatgaggagttt
tcgcagctgatgctggaggcactggatggattcttcctcgtgatgctgacagatggatat
atcatttacatctcagaaagcgtaacctctttactggagcatcttccttcggaccttatg
gatcagaaccttctaaactttcttccagtggtggatcatggagaagtgtataaagccctt
tcctcacaaccagacattgaaaacctcaactctgattacctcaagtccaagaaccagatg
gagttttgttgtcacatgctcagaggttctgtggatcccaagaaaccgcctgtatatgaa
tatgttaagtttatcggcaactttaagtcacttgtcaacatgcctcaaaaaacccgtaat
ggccttgagggaattctgcagcattcgttgcagccagccttcgatgatcaactctgtttt
attgcgactgtgcggcttgcaaagccccaattcatcaaagaaatgtgcatggtggaggag
cccaatgaagaattcacatctcgacacagtctggagtggaagttccttctattagatcac
agagctccacctatcattggctatatgccgtttgaggtattgggaacatcaggctatgac
tattatcatgtagatgacctgcattcactggccaaatgccatgagcacttaatgcagttt
ggaaaagggaagtcgtgctattatcgctttttaaccaaaggacaacagtggatttggctc
cagactaactactacatcacataccaccagtggaactcaaggccagagtttattgtgtgc
acacacactgttgtcagttatgctgaggtgcgagcagagaggaggagagagatgggaata
gaggaatctcctcctgaactcacagcggacaagaaatctggctctgaaacgcagttaaac
aacagtctgaagaaggtactagagcgtttcagtgacagtcgctcgccctccacctcctcc
aggagctcacacaagtcctcacacaccgccatctctgataacacctgcacatcaacacct
tcaaagctgcatatggatgtgagcagttccccccggcctgccaccgtggatatgatatca
cagcgccgctcctctgtcagcacacagtccatgagttcccagaacaccactcagactgac
tctccagtccaaatcagccaacaaacacaacatcaacaacctcaacaaccacagcaggtt
cagcctaatgctttgttctcagcacagctgaatgcgatgcagcacctgaaggagcagctg
gagcaaagaacacgcatgatagaagccaacattcaaaagcagcaggaggagctgagacag
attcatgagcagctgcagagagtacagggacctcagatgatcctacagcagccggctcag
ggtggtgggcctagtgtacagttgccacaagttggaggagcacagaacaacattttaggc
attgggactcaggctagcgttgtagcgatacagggccaaaatgtgacaagtacagcgcac
agcggatctgctccacagcagcaaacacttccacagcaacagactcctcgatccctgcag
cagaatctacagagctcttctgtaacacagtgcggtcctgtgtataataccatgatgatc
agccaacctgccaatgccaatgttgtgcagatacccagcaatctggcaccgaaaatcagt
caagccaatgcaattaacaggtttccagccgggcagcagttggtcacaaagattgtgacg
gctccaatggcgtgtggcgcagtcatggtgcccacgtcgatgtttatgggtcaggtggtg
accgcgtacagtccgtttacacaacaacagggtcagacgcagaccataacactgcagacg
cagcccaccgtgcctgcagaccagcagactcaggctgccacattacagagtcaacagcag
ggggcgacacagcagtcaacaaaacagcagcaaccctttttacagagcacacgtcttctc
catggcaaccagcccacacaactgatcctgcaggctttccctattcagcagcagagcaca
tttactccatcacaacaacaacaacaacagcaagtaactgaaaccacacactcagaaacc
ccagaaacaaacggcctcctctcatcagacggacagcgctag

DBGET integrated database retrieval system