KEGG   Danio rerio (zebrafish): 352927Help
Entry
352927            CDS       T01004                                 

Gene name
clockb, clock3, zfClock3
Definition
clock circadian regulator b
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    352927 (clockb)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     352927 (clockb)
Transcription factors [BR:dre03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    352927 (clockb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
1
AA seq 813 aa AA seqDB search
MSSRDRDDGSIFDGLMEEDEKDKAKRVSRNKSEKKRRDQFNVLIKELGTMLPGNTRKMDK
STILQKSIDYLRKNKENAAQSESSDIKQDWKPPFLSNEEFSQLMLEALDGFFLVMLTDGY
IIYISESVTSLLEHLPSDLMDQNLLNFLPVVDHGEVYKALSSQPDIENLNSDYLKSKNQM
EFCCHMLRGSVDPKKPPVYEYVKFIGNFKSLVNMPQKTRNGLEGILQHSLQPAFDDQLCF
IATVRLAKPQFIKEMCMVEEPNEEFTSRHSLEWKFLLLDHRAPPIIGYMPFEVLGTSGYD
YYHVDDLHSLAKCHEHLMQFGKGKSCYYRFLTKGQQWIWLQTNYYITYHQWNSRPEFIVC
THTVVSYAEVRAERRREMGIEESPPELTADKKSGSETQLNNSLKKVLERFSDSRSPSTSS
RSSHKSSHTAISDNTCTSTPSKLHMDVSSSPRPATVDMISQRRSSVSTQSMSSQNTTQTD
SPVQISQQTQHQQPQQPQQVQPNALFSAQLNAMQHLKEQLEQRTRMIEANIQKQQEELRQ
IHEQLQRVQGPQMILQQPAQGGGPSVQLPQVGGAQNNILGIGTQASVVAIQGQNVTSTAH
SGSAPQQQTLPQQQTPRSLQQNLQSSSVTQCGPVYNTMMISQPANANVVQIPSNLAPKIS
QANAINRFPAGQQLVTKIVTAPMACGAVMVPTSMFMGQVVTAYSPFTQQQGQTQTITLQT
QPTVPADQQTQAATLQSQQQGATQQSTKQQQPFLQSTRLLHGNQPTQLILQAFPIQQQST
FTPSQQQQQQQVTETTHSETPETNGLLSSDGQR
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgagctccagagacagggatgatggcagtatttttgatgggctcatggaggaagatgag
aaagataaggcgaaacgagtttcgaggaataagtcggagaagaaaaggcgggaccagttc
aacgtcctcattaaagaacttgggaccatgctgcctggaaacacacgaaagatggacaag
tctacgattttgcaaaaaagcatagactacctgcgcaagaacaaagaaaacgctgcacaa
tcggaatcgagtgacatcaagcaggattggaaacctccgtttctcagcaatgaggagttt
tcgcagctgatgctggaggcactggatggattcttcctcgtgatgctgacagatggatat
atcatttacatctcagaaagcgtaacctctttactggagcatcttccttcggaccttatg
gatcagaaccttctaaactttcttccagtggtggatcatggagaagtgtataaagccctt
tcctcacaaccagacattgaaaacctcaactctgattacctcaagtccaagaaccagatg
gagttttgttgtcacatgctcagaggttctgtggatcccaagaaaccgcctgtatatgaa
tatgttaagtttatcggcaactttaagtcacttgtcaacatgcctcaaaaaacccgtaat
ggccttgagggaattctgcagcattcgttgcagccagccttcgatgatcaactctgtttt
attgcgactgtgcggcttgcaaagccccaattcatcaaagaaatgtgcatggtggaggag
cccaatgaagaattcacatctcgacacagtctggagtggaagttccttctattagatcac
agagctccacctatcattggctatatgccgtttgaggtattgggaacatcaggctatgac
tattatcatgtagatgacctgcattcactggccaaatgccatgagcacttaatgcagttt
ggaaaagggaagtcgtgctattatcgctttttaaccaaaggacaacagtggatttggctc
cagactaactactacatcacataccaccagtggaactcaaggccagagtttattgtgtgc
acacacactgttgtcagttatgctgaggtgcgagcagagaggaggagagagatgggaata
gaggaatctcctcctgaactcacagcggacaagaaatctggctctgaaacgcagttaaac
aacagtctgaagaaggtactagagcgtttcagtgacagtcgctcgccctccacctcctcc
aggagctcacacaagtcctcacacaccgccatctctgataacacctgcacatcaacacct
tcaaagctgcatatggatgtgagcagttccccccggcctgccaccgtggatatgatatca
cagcgccgctcctctgtcagcacacagtccatgagttcccagaacaccactcagactgac
tctccagtccaaatcagccaacaaacacaacatcaacaacctcaacaaccacagcaggtt
cagcctaatgctttgttctcagcacagctgaatgcgatgcagcacctgaaggagcagctg
gagcaaagaacacgcatgatagaagccaacattcaaaagcagcaggaggagctgagacag
attcatgagcagctgcagagagtacagggacctcagatgatcctacagcagccggctcag
ggtggtgggcctagtgtacagttgccacaagttggaggagcacagaacaacattttaggc
attgggactcaggctagcgttgtagcgatacagggccaaaatgtgacaagtacagcgcac
agcggatctgctccacagcagcaaacacttccacagcaacagactcctcgatccctgcag
cagaatctacagagctcttctgtaacacagtgcggtcctgtgtataataccatgatgatc
agccaacctgccaatgccaatgttgtgcagatacccagcaatctggcaccgaaaatcagt
caagccaatgcaattaacaggtttccagccgggcagcagttggtcacaaagattgtgacg
gctccaatggcgtgtggcgcagtcatggtgcccacgtcgatgtttatgggtcaggtggtg
accgcgtacagtccgtttacacaacaacagggtcagacgcagaccataacactgcagacg
cagcccaccgtgcctgcagaccagcagactcaggctgccacattacagagtcaacagcag
ggggcgacacagcagtcaacaaaacagcagcaaccctttttacagagcacacgtcttctc
catggcaaccagcccacacaactgatcctgcaggctttccctattcagcagcagagcaca
tttactccatcacaacaacaacaacaacagcaagtaactgaaaccacacactcagaaacc
ccagaaacaaacggcctcctctcatcagacggacagcgctag

DBGET integrated database retrieval system