KEGG   Danio rerio (zebrafish): 352934Help
Entry
352934            CDS       T01004                                 

Gene name
npas2, zfCLOCK2
Definition
neuronal PAS domain protein 2
Orthology
K09026  
neuronal PAS domain-containing protein 2
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 845 aa AA seqDB search
MGEGVSMDNLSEFGGLCPSSRREWDTSSCVDDLMDEDEKDRAKRASRNKSEKKRRDQFNV
LIKELCTMLQGQGHPRKMDKSTILQRTIDFLQKQKEITAQTESCEVRQDWKPSFLSNEEF
TQLMLEALDGFLIALTTDGNIIYVSDSVSSLIGHLPSDMVDQNILNFLPEREHADVYKLL
SSHMLLTESSTVDLLNSNETHVEFCCHIARGNIDPKEPPTYEYVKFVGDFKFHNNVPLSS
CNGYDLAFPRTLQSSIEEQVCLVATVRLATPQFLKDLCNVEDVCDEFTSRHSLEWKFLFL
DHRASPIIGYLPFEVLGTSGYDYYHVDDLELIAQCHKQLMQCGKGKSCYYRFLTKGQQWI
WLQTHYYITYHQWNSKPEFIVCTHSVVSYAEVRAERRREFGLEESSSDMATSSIKGQEVF
LDMCPPLEATRDRINSARSVSSQSSRKSSHTALSDSASNSSVRYTEACTSSRQSASIGPE
KSSNRMTHTGTKTLIQRQSSSEPPSLSPSCSQHSAMTQSLYSFQQPQLGVMHQLKEQLEE
RTRILQADIKTQQQELHDIKEKLQLANLQMLLQQPIQGEFAGSGPQQQGPGRPAQQNTHP
KPQHCVSHSSHTLQPNSSSTQGQQRLVQAGHMQAVSVPMQTHTSLTTPFYSNPMMFSPNH
GHRSQHDTHCQRNTHADYSQDGQLRMLLNQPMQTLVQDSNGGPQSSQCTSTIQQTKYPLE
QQMMAPSFPVQQVNCNAVLVPSPVFTSPIMIPHNSFITHQTTPTYTTHPPVAPHSLPLQQ
PQQFFQMQPQGLIHGTPTQALFHTPSVPQQSTVGYVQPQQQQQQQQHHHHSQSGNLSDYR
NMLPR
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaggagtgagcatggacaacctttcggagtttggaggcctttgtccgtccagc
cggagggaatgggacacaagcagttgtgtggatgatttaatggacgaagatgagaaggac
agagcaaaaagggcgtcccggaacaaatcggagaagaagaggcgagaccagttcaatgtt
ctcattaaggagctgtgtacaatgctgcagggtcaaggtcacccccgcaagatggacaaa
tccaccatcctgcagaggaccatcgacttcctgcaaaaacagaaagagatcacggcacaa
acagagtcttgtgaggtccggcaggactggaagccttctttcctcagcaacgaggagttc
acccagttaatgctggaggcgttggatggttttctaatagctcttaccacagatgggaac
atcatatatgtatctgacagcgtctcgtctctcattggccatctgccgtcagatatggtg
gaccagaacatcctgaacttcctgccagagcgagagcacgcagatgtgtataaactcctg
tcttcacacatgcttctgactgagtcttctactgtagacctgctcaacagcaatgagaca
cacgtcgagttctgctgtcatatagcgaggggaaacattgacccgaaagaaccgcctacg
tacgaatatgtcaaatttgttggagatttcaagtttcataataatgtgcctctgtcttca
tgtaatggttatgatctggcgtttcctcgcacgctgcagtcctcaatagaggagcaggtc
tgcctcgtggccacagtcagactcgcaacccctcagttcctcaaggatctttgcaacgtg
gaggatgtgtgtgatgaattcacatcaagacacagtctggaatggaaatttctcttctta
gatcacagggcctctcctatcattgggtacctgccgtttgaggttttggggacctcgggt
tatgattactaccatgtggacgacctggagctgattgctcaatgtcataaacaattgatg
cagtgtgggaaaggaaagtcttgttactatcggttcctgactaaaggacagcagtggatc
tggctgcagacgcactattacatcacgtaccaccagtggaactccaaacctgagttcatc
gtctgcacacacagcgtggtcagttatgctgaagttcgagcggagagaaggagagagttt
ggattggaggagagctcatctgatatggccacatcctcaatcaaaggccaggaggtgttt
ttggacatgtgtcctcctctggaagctacacgggacagaatcaacagcgctcgatcagtg
tcatcacagagctccagaaaatcatcacacacagcgctctccgactccgcatcgaactcc
tcagtgagatacacagaagcatgtacgtcatcccggcagtctgcttccatcggccctgag
aagagctccaacagaatgacacacactggaacaaagaccctgattcagagacagagctct
tcagagcccccgtcactctctccgtcctgcagtcagcattcagccatgactcagtccctg
tacagcttccagcagcctcagttaggtgtcatgcatcagctaaaggagcagctggaggag
cgaacgcggatcctacaggccgacatcaaaacacaacagcaagagctgcacgacattaaa
gagaagctgcagctcgccaacctacagatgttactccagcagccgatacagggagagttt
gctggttctggtccacagcagcagggtccaggcaggccggctcaacaaaacacacaccct
aaacctcaacactgtgtatcacattcatcacacacactacaacccaacagctcatccact
caggggcagcagaggctggttcaggctggacacatgcaggccgtcagtgttccaatgcag
acacacaccagtctgaccacacccttctacagcaaccccatgatgttctcccccaaccac
ggacaccgaagccaacatgacacacactgccaaagaaacacacacgccgactacagccag
gacggacagctacggatgctgctaaaccagccaatgcaaacacttgtacaagacagcaat
ggggggccccagtcttcccaatgcacctcaactattcaacaaaccaaatatcctctggag
cagcagatgatggctccttccttccctgtgcagcaggtgaactgtaacgctgtgctagtc
ccctcccccgtcttcacctcaccaatcatgatcccccataatagtttcatcacccatcag
accacccccacctacacgactcacccgccggttgccccacacagcttaccactacagcag
cctcagcagttctttcagatgcagcctcagggtctgattcacggcactcccactcaggcc
ttattccacacccctagtgttccacagcaaagcactgtgggatacgtacagccacaacag
cagcagcagcaacagcagcatcatcatcactcccagtctggcaacctgtcggactacaga
aacatgctccctcggtag

DBGET integrated database retrieval system