KEGG   Danio rerio (zebrafish): 352940Help
Entry
352940            CDS       T01004                                 

Gene name
fgfr2, fc56c05, fgfr-2, wu:fc56c05
Definition
fibroblast growth factor receptor 2 (EC:2.7.10.1)
Orthology
K05093  
fibroblast growth factor receptor 2 [EC:2.7.10.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Endocytosis
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:dre04010]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:dre04144]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:dre04810]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
13
AA seq 817 aa AA seqDB search
MFARGWLLGALLLMTLATVSVARPSLKIDLVNTSAPEEPPTKNQNCVPVLFSVHPGELLK
LKCPLSGADDVVWTKDSSSLRPDNRTLVTRDWLQISDATPKDSGLYSCSATGSRDCDVFS
FIVNVTDAISSGDDEDDTERSDDVGADGEQMRLPYWTFPEKMEKKLHAVPAANTVKFRCA
AAGNPKPKMRWLKNAKPFRQEDRMGGYKVRLQHWTLIMESVVPSDKGNYTCLVENQYGSI
NHTYTLDVVERSPHRPILQAGLPANVTVQVGQDAKFVCKVYSDAQPHIQWLQHYTKNGSR
YGPDGLPYVRVLKTAGVNTTDKEIEVLYLPNVTFEDAGEYTCLAGNSIGISYHTAWLTVH
PAETNPIETDYPPDYVEIAIYCIGVFLIACMVVIVVVCRMRTSAKKPDFSSQPAVHKLTK
QIPLRRQVTVSSDSSSSMSSSTPLVRITTRRSSAHDDPIPEYDLPEDPRWEFSRDKLTLG
KPLGEGCFGQVVMAEALGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGRH
KNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDIARVSDEPLTFKDLV
SCTYQVARGMEYLASQKCIHRDLAARNVLVTESNVMKIADFGLARDVHNIDYYKKTTNGR
LPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDK
PANCTNELYMMMKDCWHAISSHRPTFKQLVEDLDRILTLATNEEYLDLCAPVEQYSPSFP
DTRSSCSSGDDSVFSHDPLADEPCLPKYQHINGGIKT
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcccgagggtggcttctgggtgctctcctgctaatgaccctggcaacggtatct
gtggcacggccgtcattgaagattgacttggtgaatacatctgcacctgaagagcctcca
accaaaaaccaaaactgtgtgcccgtcctgttctcggtgcacccgggtgagctgctcaag
ctcaagtgcccgctgtccggggcagatgacgtcgtctggaccaaagacagctcctcgctg
cgccccgacaaccgcacgctcgtaactcgggattggctgcagatcagcgacgccaccccg
aaggactcgggcctgtattcgtgcagtgccacgggctcgcgggactgcgatgtgtttagc
ttcatcgtaaacgttacagatgccatctcatccggtgacgatgaggacgacacagagcgg
tcagacgatgttggggcagacggtgaacaaatgcggctgccatattggacctttccagag
aagatggagaagaagctgcatgccgtcccggcggccaacacggtgaagtttcgctgcgcg
gcagccggaaatcctaaacccaaaatgcgctggctgaaaaacgcaaaacccttcagacag
gaggatcgcatgggcggctacaaggttcgactccagcactggaccctgatcatggagagc
gtggttccctctgataaaggaaactacacctgtctggtggagaaccagtatggctccatc
aatcacacatacacgctggatgtcgttgaacgctctcctcaccggcccattctccaggca
ggcctgccagcaaacgtcactgtgcaagttggacaagatgcgaagttcgtctgtaaagtt
tacagtgatgctcagcctcatatccagtggttgcagcactatacgaagaacggcagccgc
tatggtcctgatggacttccttatgtccgcgtattgaagacggcaggtgtgaacactacg
gataaagagatcgaggtgctctacctgcctaatgtaactttcgaggatgcgggcgagtat
acgtgtttggcgggtaactctattgggatctcctatcacactgcttggttgacggtgcat
ccagctgagacgaatcccatcgagacggattatcctccagattatgtggagatcgccatc
tactgtataggtgtgtttctgatcgcctgtatggtggtgatcgtggtggtttgccggatg
aggacgtcggctaagaagcctgatttcagcagtcagccagcagtgcacaagctcaccaaa
cagatccccctgcgccgccaggtaacagtgtcgtcagactccagctcctccatgagctct
agcacgccattggtcagaatcaccactcgccggagctccgcccacgatgatcccattcca
gaatacgacctccctgaggacccacgctgggagttttctagagacaagttaactctgggt
aagcctctcggcgagggctgctttggtcaggttgtgatggctgaagctcttggcattgac
aaggacaaaccgaaagaggctgtgactgtggctgtcaagatgctaaaagatgatgcgacc
gagaaggatctttctgacctggtgtcagagatggagatgatgaagatgattggccggcac
aagaacatcatcaatctgttgggagcgtgcacacaggatggtccattatatgtcattgtt
gagtatgcatctaaagggaacctccgggagtatctgagggcccggcggcccccaggaatg
gagtattcctatgatatagcccgcgtatcagatgagcctctcactttcaaagatctggtc
tcctgcacttatcaagttgcccgtggcatggagtatttagcctctcagaagtgtatacac
cgagatttggccgcgaggaatgtgttggtcacggagagcaacgttatgaagatcgcagac
ttcggtctggccagagacgtccacaacatagattactataaaaagaccacaaatggtcgt
ctgcctgtgaaatggatggctccagaagcactgttcgaccgagtttatacacaccagagt
gacgtctggtcgtttggggttttaatgtgggagatcttcactctcggcggttctccgtat
cctggaatacctgtcgaggagctctttaaactattaaaagagggtcatcgcatggacaaa
cctgctaactgcaccaatgagttgtacatgatgatgaaggactgctggcatgccatctcc
tcccacagacccacattcaagcagttggtggaggatctggaccgcattctcactctggca
accaacgaggaatatctggacctgtgtgccccggtggagcaatactctcccagcttcccc
gacacacgcagctcctgctcctccggagacgactccgtattttcccatgatcccttagcg
gacgagccctgccttcccaaataccagcacatcaacggcggcataaaaacatga

DBGET integrated database retrieval system