KEGG   Danio rerio (zebrafish): 352940Help
Entry
352940            CDS       T01004                                 

Gene name
fgfr2, fc56c05, fgfr-2, wu:fc56c05
Definition
fibroblast growth factor receptor 2 (EC:2.7.10.1)
Orthology
K05093  
fibroblast growth factor receptor 2 [EC:2.7.10.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Endocytosis
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    352940 (fgfr2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    352940 (fgfr2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    352940 (fgfr2)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     352940 (fgfr2)
Protein kinases [BR:dre01001]
 Tyrosine protein kinases
  FGFR family [OT]
   352940 (fgfr2)
Enzyme-linked receptors [BR:dre01020]
 Receptor tyrosine kinases
  RTK class IV (FGF receptor family)
   352940 (fgfr2)
Cytokine receptors [BR:dre04050]
 Receptor tyrosine kinase
  RTK class IV (FGF receptor family)
   352940 (fgfr2)
Cellular antigens [BR:dre04090]
 Proteins
  352940 (fgfr2)
Heparan sulfate/heparin binding proteins [BR:dre00536]
 Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
  352940 (fgfr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
13
AA seq 817 aa AA seqDB search
MFARGWLLGALLLMTLATVSVARPSLKIDLVNTSAPEEPPTKNQNCVPVLFSVHPGELLK
LKCPLSGADDVVWTKDSSSLRPDNRTLVTRDWLQISDATPKDSGLYSCSATGSRDCDVFS
FIVNVTDAISSGDDEDDTERSDDVGADGEQMRLPYWTFPEKMEKKLHAVPAANTVKFRCA
AAGNPKPKMRWLKNAKPFRQEDRMGGYKVRLQHWTLIMESVVPSDKGNYTCLVENQYGSI
NHTYTLDVVERSPHRPILQAGLPANVTVQVGQDAKFVCKVYSDAQPHIQWLQHYTKNGSR
YGPDGLPYVRVLKTAGVNTTDKEIEVLYLPNVTFEDAGEYTCLAGNSIGISYHTAWLTVH
PAETNPIETDYPPDYVEIAIYCIGVFLIACMVVIVVVCRMRTSAKKPDFSSQPAVHKLTK
QIPLRRQVTVSSDSSSSMSSSTPLVRITTRRSSAHDDPIPEYDLPEDPRWEFSRDKLTLG
KPLGEGCFGQVVMAEALGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGRH
KNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDIARVSDEPLTFKDLV
SCTYQVARGMEYLASQKCIHRDLAARNVLVTESNVMKIADFGLARDVHNIDYYKKTTNGR
LPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDK
PANCTNELYMMMKDCWHAISSHRPTFKQLVEDLDRILTLATNEEYLDLCAPVEQYSPSFP
DTRSSCSSGDDSVFSHDPLADEPCLPKYQHINGGIKT
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcccgagggtggcttctgggtgctctcctgctaatgaccctggcaacggtatct
gtggcacggccgtcattgaagattgacttggtgaatacatctgcacctgaagagcctcca
accaaaaaccaaaactgtgtgcccgtcctgttctcggtgcacccgggtgagctgctcaag
ctcaagtgcccgctgtccggggcagatgacgtcgtctggaccaaagacagctcctcgctg
cgccccgacaaccgcacgctcgtaactcgggattggctgcagatcagcgacgccaccccg
aaggactcgggcctgtattcgtgcagtgccacgggctcgcgggactgcgatgtgtttagc
ttcatcgtaaacgttacagatgccatctcatccggtgacgatgaggacgacacagagcgg
tcagacgatgttggggcagacggtgaacaaatgcggctgccatattggacctttccagag
aagatggagaagaagctgcatgccgtcccggcggccaacacggtgaagtttcgctgcgcg
gcagccggaaatcctaaacccaaaatgcgctggctgaaaaacgcaaaacccttcagacag
gaggatcgcatgggcggctacaaggttcgactccagcactggaccctgatcatggagagc
gtggttccctctgataaaggaaactacacctgtctggtggagaaccagtatggctccatc
aatcacacatacacgctggatgtcgttgaacgctctcctcaccggcccattctccaggca
ggcctgccagcaaacgtcactgtgcaagttggacaagatgcgaagttcgtctgtaaagtt
tacagtgatgctcagcctcatatccagtggttgcagcactatacgaagaacggcagccgc
tatggtcctgatggacttccttatgtccgcgtattgaagacggcaggtgtgaacactacg
gataaagagatcgaggtgctctacctgcctaatgtaactttcgaggatgcgggcgagtat
acgtgtttggcgggtaactctattgggatctcctatcacactgcttggttgacggtgcat
ccagctgagacgaatcccatcgagacggattatcctccagattatgtggagatcgccatc
tactgtataggtgtgtttctgatcgcctgtatggtggtgatcgtggtggtttgccggatg
aggacgtcggctaagaagcctgatttcagcagtcagccagcagtgcacaagctcaccaaa
cagatccccctgcgccgccaggtaacagtgtcgtcagactccagctcctccatgagctct
agcacgccattggtcagaatcaccactcgccggagctccgcccacgatgatcccattcca
gaatacgacctccctgaggacccacgctgggagttttctagagacaagttaactctgggt
aagcctctcggcgagggctgctttggtcaggttgtgatggctgaagctcttggcattgac
aaggacaaaccgaaagaggctgtgactgtggctgtcaagatgctaaaagatgatgcgacc
gagaaggatctttctgacctggtgtcagagatggagatgatgaagatgattggccggcac
aagaacatcatcaatctgttgggagcgtgcacacaggatggtccattatatgtcattgtt
gagtatgcatctaaagggaacctccgggagtatctgagggcccggcggcccccaggaatg
gagtattcctatgatatagcccgcgtatcagatgagcctctcactttcaaagatctggtc
tcctgcacttatcaagttgcccgtggcatggagtatttagcctctcagaagtgtatacac
cgagatttggccgcgaggaatgtgttggtcacggagagcaacgttatgaagatcgcagac
ttcggtctggccagagacgtccacaacatagattactataaaaagaccacaaatggtcgt
ctgcctgtgaaatggatggctccagaagcactgttcgaccgagtttatacacaccagagt
gacgtctggtcgtttggggttttaatgtgggagatcttcactctcggcggttctccgtat
cctggaatacctgtcgaggagctctttaaactattaaaagagggtcatcgcatggacaaa
cctgctaactgcaccaatgagttgtacatgatgatgaaggactgctggcatgccatctcc
tcccacagacccacattcaagcagttggtggaggatctggaccgcattctcactctggca
accaacgaggaatatctggacctgtgtgccccggtggagcaatactctcccagcttcccc
gacacacgcagctcctgctcctccggagacgactccgtattttcccatgatcccttagcg
gacgagccctgccttcccaaataccagcacatcaacggcggcataaaaacatga

DBGET integrated database retrieval system