KEGG   Danio rerio (zebrafish): 360144Help
Entry
360144            CDS       T01004                                 

Gene name
mapk1, zERK2
Definition
mitogen-activated protein kinase 1 (EC:2.7.11.24)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Oocyte meiosis
mTOR signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Dorso-ventral axis formation
TGF-beta signaling pathway
VEGF signaling pathway
Focal adhesion
Adherens junction
Gap junction
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Salmonella infection
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:dre04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:dre04012]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:dre04350]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:dre04370]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dre04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dre04150]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:dre04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:dre04114]
Cellular Processes; Cell communication; Focal adhesion [PATH:dre04510]
Cellular Processes; Cell communication; Adherens junction [PATH:dre04520]
Cellular Processes; Cell communication; Gap junction [PATH:dre04540]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:dre04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:dre04621]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:dre04910]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:dre04912]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:dre04914]
Organismal Systems; Endocrine system; Melanogenesis [PATH:dre04916]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:dre04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:dre04270]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:dre04320]
Human Diseases; Infectious diseases; Salmonella infection [PATH:dre05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 369 aa AA seqDB search
MATAAVSAPAGGGPNPGSGAEMVRGQAFDVGPRYSNLSYIGGGAYGMVCSAYDRDNKVRV
AIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRTPTIDQMKDVYIVQDLMETD
LYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLA
RVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGK
HYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRSKVPWNRLFPNADPKALDLLD
KMLTFNPHKRIEVEEALAHPYLEQYYDPTDEPVAEAPFKFDMELDDLPKETLKELIFEET
ARFQPGYRP
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagctgcggtttctgcccctgctggcggcggcccgaaccccggatccggtgcc
gagatggtccgcgggcaggctttcgatgtcgggccgcgttacagcaacctctcctacatc
ggaggaggcgcttacggcatggtttgttcagcatatgaccgtgacaataaagtacgtgtg
gcgatcaagaagatcagcccgtttgagcaccagacgtactgtcagcgcacactgcgtgag
attaaaatcctgctccgcttcaagcatgaaaacatcatcggtatcaacgacatcatccgc
acgcccaccatcgaccagatgaaagacgtttacatcgtacaggacctgatggagacagac
ttgtacaagctgttgaagacgcagcacttgagcaatgaccacatctgttacttcctgtat
cagatcctgcgcggcctgaagtacatccactccgcaaacgttcttcaccgagacctgaag
ccatcaaacctgttgctcaacactacctgtgacctcaagatctgtgattttgggctcgct
cgggtggctgatccagatcatgaccacaccggcttcctgacggagtatgtagccacacgt
tggtaccgcgcaccagaaattatgctcaattctaagggttacactaaatccattgatata
tggtctgttggttgtattctggctgagatgctttcaaatagacccatcttccccgggaaa
cactatctggaccagcttaaccacatcttaggtattttgggctccccttctcaggaggac
ctgaactgcatcatcaacattaaagcaagaaattacctgctgtcccttcctctccgcagc
aaagtgccctggaaccgcctgtttcccaacgcagaccctaaagcgctggacctgttggat
aagatgttgacctttaacccccataagaggattgaggtggaggaagcgctcgctcacccg
tacctggagcagtactatgatcctacagatgagcctgttgctgaggctccgttcaagttc
gacatggagctggatgatttgcccaaagagactctgaaagagctgatctttgaagagacc
gcacgcttccagccaggctacagaccatag

DBGET integrated database retrieval system