KEGG   Danio rerio (zebrafish): 360144Help
Entry
360144            CDS       T01004                                 

Gene name
mapk1, zERK2
Definition
mitogen-activated protein kinase 1 (EC:2.7.11.24)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Oocyte meiosis
mTOR signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Dorso-ventral axis formation
TGF-beta signaling pathway
VEGF signaling pathway
Focal adhesion
Adherens junction
Gap junction
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    360144 (mapk1)
   04012 ErbB signaling pathway
    360144 (mapk1)
   04350 TGF-beta signaling pathway
    360144 (mapk1)
   04370 VEGF signaling pathway
    360144 (mapk1)
   04068 FoxO signaling pathway
    360144 (mapk1)
   04150 mTOR signaling pathway
    360144 (mapk1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    360144 (mapk1)
  Cell growth and death
   04114 Oocyte meiosis
    360144 (mapk1)
  Cell communication
   04510 Focal adhesion
    360144 (mapk1)
   04520 Adherens junction
    360144 (mapk1)
   04540 Gap junction
    360144 (mapk1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    360144 (mapk1)
   04621 NOD-like receptor signaling pathway
    360144 (mapk1)
  Endocrine system
   04910 Insulin signaling pathway
    360144 (mapk1)
   04912 GnRH signaling pathway
    360144 (mapk1)
   04914 Progesterone-mediated oocyte maturation
    360144 (mapk1)
   04916 Melanogenesis
    360144 (mapk1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    360144 (mapk1)
   04270 Vascular smooth muscle contraction
    360144 (mapk1)
  Development
   04320 Dorso-ventral axis formation
    360144 (mapk1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    360144 (mapk1)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     360144 (mapk1)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   360144 (mapk1)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   360144 (mapk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 369 aa AA seqDB search
MATAAVSAPAGGGPNPGSGAEMVRGQAFDVGPRYSNLSYIGGGAYGMVCSAYDRDNKVRV
AIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRTPTIDQMKDVYIVQDLMETD
LYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLA
RVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGK
HYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRSKVPWNRLFPNADPKALDLLD
KMLTFNPHKRIEVEEALAHPYLEQYYDPTDEPVAEAPFKFDMELDDLPKETLKELIFEET
ARFQPGYRP
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagctgcggtttctgcccctgctggcggcggcccgaaccccggatccggtgcc
gagatggtccgcgggcaggctttcgatgtcgggccgcgttacagcaacctctcctacatc
ggaggaggcgcttacggcatggtttgttcagcatatgaccgtgacaataaagtacgtgtg
gcgatcaagaagatcagcccgtttgagcaccagacgtactgtcagcgcacactgcgtgag
attaaaatcctgctccgcttcaagcatgaaaacatcatcggtatcaacgacatcatccgc
acgcccaccatcgaccagatgaaagacgtttacatcgtacaggacctgatggagacagac
ttgtacaagctgttgaagacgcagcacttgagcaatgaccacatctgttacttcctgtat
cagatcctgcgcggcctgaagtacatccactccgcaaacgttcttcaccgagacctgaag
ccatcaaacctgttgctcaacactacctgtgacctcaagatctgtgattttgggctcgct
cgggtggctgatccagatcatgaccacaccggcttcctgacggagtatgtagccacacgt
tggtaccgcgcaccagaaattatgctcaattctaagggttacactaaatccattgatata
tggtctgttggttgtattctggctgagatgctttcaaatagacccatcttccccgggaaa
cactatctggaccagcttaaccacatcttaggtattttgggctccccttctcaggaggac
ctgaactgcatcatcaacattaaagcaagaaattacctgctgtcccttcctctccgcagc
aaagtgccctggaaccgcctgtttcccaacgcagaccctaaagcgctggacctgttggat
aagatgttgacctttaacccccataagaggattgaggtggaggaagcgctcgctcacccg
tacctggagcagtactatgatcctacagatgagcctgttgctgaggctccgttcaagttc
gacatggagctggatgatttgcccaaagagactctgaaagagctgatctttgaagagacc
gcacgcttccagccaggctacagaccatag

DBGET integrated database retrieval system