KEGG   Danio rerio (zebrafish): 360218Help
Entry
360218            CDS       T01004                                 

Gene name
pbk, topk, zgc:92050
Definition
PDZ binding kinase (EC:2.7.12.2)
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     360218 (pbk)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   360218 (pbk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
20
AA seq 339 aa AA seqDB search
MEASKESPSAFKTPCKPAKVKSPVNACGTPVTIPASPFMKKLGCGTGVNVYLMNRMGKQT
HSPWAIKKINSKCAQGQVSVYQKRLCEEAKILKDLKHPNIVGFRAFTTAKDGSKCLAMEF
GGEQSLNDLIEKRREEGLQAFPVDTIEKVALHVARGLLYLHNEKKLLHGDMKSCNVVIKG
DFESIKICDVGVSLPLDENMQVSDPKAHYIGTEPWKPKEALEDGVITDKADIFAYGLTLW
EMMTLSVPHLEMLDTEGDEDDDDESFEEDFDEDAYYERLGSRPALDAVTLGGSYQRMVEL
FCLCTEEDPQKRPSAAHIVQVLESNSQLSKQNTEVIVID
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggaggccagcaaagaatcaccgagtgcctttaaaacaccttgcaagcctgctaaagtg
aaaagtccagtcaatgcttgtgggaccccagtcaccattcctgcctctcccttcatgaag
aagctcggctgtgggactggagtcaatgtttacctcatgaacaggatggggaaacagact
cattctccatgggctataaagaagatcaacagcaagtgtgctcaaggtcaagtgagtgtt
tatcagaagcgtctctgtgaggaggccaagatcttgaaggacctcaagcaccccaatatt
gttggcttcagagcttttaccactgcgaaggatggctcgaagtgtctagcgatggagttt
ggcggagaacagtctctcaatgacctgattgagaagaggagagaggagggtctgcaggcc
tttccagtggacactattgaaaaagtggctcttcatgtcgctcgcggtttactgtacttg
cacaatgagaaaaagcttctgcatggagacatgaaatcatgcaatgttgtcatcaagggc
gattttgagagcatcaaaatctgtgatgttggtgtttcactgccactggatgaaaacatg
caagtgagtgatccaaaggctcattacattgggacggagccgtggaagcccaaagaagct
ttggaggatggagtaatcacagataaagctgatatctttgcctatggactcacactgtgg
gaaatgatgacgctttctgttcctcacctggagatgctggacactgagggtgatgaagat
gatgatgacgagtcatttgaggaggattttgatgaagatgcatattatgagcggctgggg
tctcgaccggctctggacgcagtgactctgggaggctcttatcagaggatggtggagctc
ttctgtctctgcacagaggaggaccctcagaaaagaccctcagcagctcacattgtgcag
gtgctggagtcaaacagccagctttccaagcaaaacactgaggtaattgtaatcgattaa

DBGET integrated database retrieval system