KEGG   Danio rerio (zebrafish): 368262Help
Entry
368262            CDS       T01004                                 

Gene name
dlst, cb60, wu:fc39d01
Definition
dihydrolipoamide S-succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dre  Danio rerio (zebrafish)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    368262 (dlst)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    368262 (dlst)
  Amino acid metabolism
   00310 Lysine degradation
    368262 (dlst)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     368262 (dlst)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
17
AA seq 458 aa AA seqDB search
MLCHSRCLSRSLGRSITALRQGNSVLARRATSGIAASQCVSFQDSPRCETRSSVYQIRYF
KTTAAHRNEVITVKTPAFAESVTEGDVRWEKAVGDSVAEDEVVCEIETDKTSVQVPSPAA
GVIEELLVPDGGKVEGGTPLFKLKKGAGAVKTAAAVGAPPPAAKTPAPAAPAPAAAPAGG
PIPSSMPPVPAVPAQPIQAKPVSAIKPTAAAPAAAAADTGAKAPRSEHRVKMNRMRLRIA
QRLKEAQNTCAMLTTFNEVDMSNITEMRTHYKDAFLKKHGIKLGFMSAFVKAAAYALTDQ
PAVNAVIDDTTKEIVYRDYVDISVAVATPKGLVVPVIRGVEGMNFADIEKTINELGEKAR
KNELAVEDMDGGTFTISNGGVFGSMFGTPIINPPQSAILGMHGIFDRPVAIAGKVEVRPM
MYVALTYDHRLIDGREAVTFLRKIKSVVEDPRVLLLDM
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgtcattcccgctgtctgagccggagcctcggccgctcgatcaccgccctgaga
cagggtaacagtgttctcgcaagacgggctacatcaggtatagcagctagtcagtgtgtc
agcttccaggacagcccgaggtgtgagacccgctctagtgtctatcagatcagatacttc
aagaccacagccgctcacaggaatgaagtcattacagtaaaaaccccagcgtttgcggag
tctgtcacagagggagatgtcaggtgggagaaagctgttggagactcagtcgctgaggat
gaggtcgtctgtgaaatcgagaccgataagacgtcagtgcaggtcccctctccggctgca
ggagtgatcgaggagctgctggttcctgatggaggaaaagtggaaggaggaactcctctg
ttcaagctcaagaaaggagctggagcggtgaagacggcagcagcggtgggggctcctcct
ccagcagcaaagacccctgctcctgcagcccctgcccctgctgctgcccctgcgggtgga
cccataccctccagcatgcctcctgtacccgctgtgccagcccagcccatccaggccaaa
ccagtttcagccatcaaacccactgctgctgctcctgctgctgctgctgcagacactgga
gctaaagctccccgatcagagcacagggtgaagatgaaccgcatgcgactgcgaatcgct
cagcggctgaaggaagcgcagaacacctgtgccatgctgaccaccttcaatgaagtcgat
atgagcaacatcacagagatgaggacacattataaagatgctttcctgaagaaacacggc
atcaagctgggcttcatgtctgccttcgtcaaagctgcagcctacgctctaacagaccag
cctgccgttaatgctgtcattgatgacacaaccaaagagatcgtgtatcgggattatgtg
gacatcagtgtggcggtggcgacaccaaagggtctggtggtaccggtgatcagaggtgtg
gagggaatgaacttcgcagacatcgagaagaccattaatgagctgggagagaaggcccgt
aagaatgagctggctgtggaggatatggatggaggaacgtttaccatcagcaatggagga
gttttcggctccatgttcgggactccaatcatcaacccgccacagtctgccatcctgggc
atgcatggcatcttcgaccggcctgtggccatcgctggcaaggtggaggtgcggccgatg
atgtacgtggctctgacctacgaccaccgcttgattgacggcagagaggcggtcactttc
ctcaggaagatcaagtctgtggtggaggacccgcgggtgctgctgctggacatgtaa

DBGET integrated database retrieval system