KEGG   Danio rerio (zebrafish): 368262Help
Entry
368262            CDS       T01004                                 

Gene name
dlst, cb60, wu:fc39d01
Definition
(RefSeq) dihydrolipoamide S-succinyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dre  Danio rerio (zebrafish)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    368262 (dlst)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    368262 (dlst)
  Amino acid metabolism
   00310 Lysine degradation
    368262 (dlst)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     368262 (dlst)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
17
AA seq 458 aa AA seqDB search
MLCHSRCLSRSLGRSITALRQGNSVLARRATSGIAASQCVSFQDSPRCETRSSVYQIRYF
KTTAAHRNEVITVKTPAFAESVTEGDVRWEKAVGDSVAEDEVVCEIETDKTSVQVPSPAA
GVIEELLVPDGGKVEGGTPLFKLKKGAGAVKTAAAVGAPPPAAKTPAPAAPAPAAAPAGG
PIPSSMPPVPAVPAQPIQAKPVSAIKPTAAAPAAAAADTGAKAPRSEHRVKMNRMRLRIA
QRLKEAQNTCAMLTTFNEVDMSNITEMRTHYKDAFLKKHGIKLGFMSAFVKAAAYALTDQ
PAVNAVIDDTTKEIVYRDYVDISVAVATPKGLVVPVIRGVEGMNFADIEKTINELGEKAR
KNELAVEDMDGGTFTISNGGVFGSMFGTPIINPPQSAILGMHGIFDRPVAIAGKVEVRPM
MYVALTYDHRLIDGREAVTFLRKIKSVVEDPRVLLLDM
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgtcattcccgctgtctgagccggagcctcggccgctcgatcaccgccctgaga
cagggtaacagtgttctcgcaagacgggctacatcaggtatagcagctagtcagtgtgtc
agcttccaggacagcccgaggtgtgagacccgctctagtgtctatcagatcagatacttc
aagaccacagccgctcacaggaatgaagtcattacagtaaaaaccccagcgtttgcggag
tctgtcacagagggagatgtcaggtgggagaaagctgttggagactcagtcgctgaggat
gaggtcgtctgtgaaatcgagaccgataagacgtcagtgcaggtcccctctccggctgca
ggagtgatcgaggagctgctggttcctgatggaggaaaagtggaaggaggaactcctctg
ttcaagctcaagaaaggagctggagcggtgaagacggcagcagcggtgggggctcctcct
ccagcagcaaagacccctgctcctgcagcccctgcccctgctgctgcccctgcgggtgga
cccataccctccagcatgcctcctgtacccgctgtgccagcccagcccatccaggccaaa
ccagtttcagccatcaaacccactgctgctgctcctgctgctgctgctgcagacactgga
gctaaagctccccgatcagagcacagggtgaagatgaaccgcatgcgactgcgaatcgct
cagcggctgaaggaagcgcagaacacctgtgccatgctgaccaccttcaatgaagtcgat
atgagcaacatcacagagatgaggacacattataaagatgctttcctgaagaaacacggc
atcaagctgggcttcatgtctgccttcgtcaaagctgcagcctacgctctaacagaccag
cctgccgttaatgctgtcattgatgacacaaccaaagagatcgtgtatcgggattatgtg
gacatcagtgtggcggtggcgacaccaaagggtctggtggtaccggtgatcagaggtgtg
gagggaatgaacttcgcagacatcgagaagaccattaatgagctgggagagaaggcccgt
aagaatgagctggctgtggaggatatggatggaggaacgtttaccatcagcaatggagga
gttttcggctccatgttcgggactccaatcatcaacccgccacagtctgccatcctgggc
atgcatggcatcttcgaccggcctgtggccatcgctggcaaggtggaggtgcggccgatg
atgtacgtggctctgacctacgaccaccgcttgattgacggcagagaggcggtcactttc
ctcaggaagatcaagtctgtggtggaggacccgcgggtgctgctgctggacatgtaa

DBGET integrated database retrieval system