KEGG   Danio rerio (zebrafish): 368912Help
Entry
368912            CDS       T01004                                 

Gene name
echs1, fj55e05, si:zc217g15.1, wu:fj55e05
Definition
enoyl CoA hydratase, short chain, 1, mitochondrial (EC:4.2.1.17)
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dre  Danio rerio (zebrafish)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    368912 (echs1)
   01212 Fatty acid metabolism
    368912 (echs1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    368912 (echs1)
   00650 Butanoate metabolism
    368912 (echs1)
  Lipid metabolism
   00062 Fatty acid elongation
    368912 (echs1)
   00071 Fatty acid degradation
    368912 (echs1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    368912 (echs1)
   00310 Lysine degradation
    368912 (echs1)
   00380 Tryptophan metabolism
    368912 (echs1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    368912 (echs1)
Enzymes [BR:dre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     368912 (echs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
13
AA seq 291 aa AA seqDB search
MALLCRSTGLLLKHSKLLPSALAATRQSSSGVQYEYILVDKKGEKKNVGFIQLNRPKALN
ALCDGLMLEVGKALDAFEMDSEVGAIVVTGSEKAFAAGADIKEMQNRTFQECYGGNFLAH
WNRVSTVKKPVIAAVNGFALGGGCEFAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRL
TRAVGKSLAMEMVLTGDRISAQEAKQSGLVSKIFPVDQLVPEAIKCGEKIAGNSKLVSAM
AKESVNAAFELTLAEGSRFEKRLFHATFATEDRKEGMSAFVEKRKAAFQDK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgctctgcagatcaacagggttacttctcaaacacagcaaactgctgccctct
gctttagcagcgacaaggcaatccagttcaggtgtccagtatgagtacattctggtggac
aaaaagggtgaaaagaagaatgttggcttcatccagctgaacagaccaaaggccctgaat
gctctttgtgatggactcatgctggaggtgggcaaagcgctcgatgcatttgagatggac
agtgaagtgggagcaatcgtcgtcaccgggagtgaaaaagcctttgcagctggtgctgac
attaaagagatgcagaatcgaaccttccaagagtgttatggtggaaacttcttggcacat
tggaacagggtatcaacagtcaagaagcctgttattgctgcggtcaatgggtttgcgctt
ggcggaggatgtgagtttgctatgatgtgtgacatcatctatgctggagagaaggcacag
ttcggacagccagaaatcctgcttgggaccattcctggtgctggtggcactcagaggctt
acaagagcagttggaaaatcccttgcgatggagatggttctcactggagaccgaatctca
gcccaggaggcaaaacagtctggcctggttagtaaaatatttcctgtggatcagctggtt
ccagaagcgatcaaatgtggagagaaaatcgctggcaattccaaactggtctcagccatg
gcaaaggaatctgttaatgccgcatttgaactgactttagctgagggcagtcggtttgag
aaaagattgttccatgcaacctttgctacggaggacagaaaggagggcatgtctgccttt
gttgagaagagaaaggctgctttccaggacaagtaa

DBGET integrated database retrieval system