KEGG   Danio rerio (zebrafish): 373082Help
Entry
373082            CDS       T01004                                 

Gene name
gys2, cb765, zgc:112057
Definition
glycogen synthase 2 (EC:2.4.1.11)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    373082 (gys2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    373082 (gys2)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     373082 (gys2)
Glycosyltransferases [BR:dre01003]
 Polysaccharide
  Storage polysaccharide
   373082 (gys2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
4
AA seq 701 aa AA seqDB search
MRLSRSLSITSLSGLPLFEEESLPVEDLLLFEVAWEVTNKVGGIYTVIQTKAKITVDEWG
ENYFMMGPYYEHNFKTQVEKCEPPNQAIRAAMDSLINNGCQVHFGRWLIEGSPYVILFDI
GAAAWNLDRWKGDLWSACGIGLPYHDREANDSLILGSLVAWFFKELTDQLQDKLNVVAHF
HEWQAGTGLVLSRSRNLPLATIFTTHATLLGRYLCAGNADFYNNLDKFDIDREAGERQIY
HRYCLERAAVHCAHVFTTVSQITAVEADHMLHRNPDVVTPNGLNVRKFSAMHEFQNLHSM
NKSKIQEFVRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGADLFLESLSRLNYLLRVHKSD
VTVVVFFIMPAKTNNFNVESLKGQAVRKQLWDTAQSVKEKFGKKLYESLLRGEIPDMSKI
LDRDDFTIMKRAIYATQRHSLPPVTTHNMLDDSTDPILGNIRRIGLFNGRNDRVKIVFHP
EFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFME
EHVSDPSEYGIYIVDRRFRSADESCNQLTQFMFSFCQKSRRQRIIQRNRTERLSDLLDWR
YLGRFYMHARHLALSRSFPEKFRPEHLNLTSTQGFRYPRPSSVPPSPSASIHSTPHHSDE
EDDDTYDEEEEAERDRLNIKAPFSVGADTDGKRTQPVENGN
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgcgactatccagatctttgtcaataacatcattaagtggacttccactgtttgaagag
gaaagtctacctgttgaagatctcctgctctttgaggttgcgtgggaagtcaccaataaa
gtgggaggaatttacactgttatccagacaaaagcaaagatcactgtggacgaatggggt
gaaaactacttcatgatgggaccttactatgaacacaacttcaagactcaggtggagaaa
tgtgaacctccaaaccaagccatcagagctgccatggactccctgatcaacaacggctgc
caggttcactttggccgttggctgattgagggcagtccatatgtgattctctttgacatt
ggtgctgccgcctggaacctggaccgctggaagggggatctgtggagcgcctgcggcatt
ggcctgccatatcatgaccgagaggccaacgactcactcatcctgggctctctggtggcc
tggttcttcaaagagttaacagaccagcttcaggacaagctcaatgtagttgctcacttc
catgagtggcaggctgggacaggactggtactgagccgctcccgaaatcttcccctggcg
actattttcaccactcatgccaccctgctgggtcgatacctgtgcgctggaaatgctgac
ttctacaacaacctggataagtttgacattgacagagaggctggagagagacagatctac
caccggtattgtttggagagagctgcggttcactgtgcgcacgtctttacaaccgtgtcc
caaatcacagcagtggaggccgatcacatgcttcacagaaacccagatgtcgtcaccccc
aacggcctgaatgttaggaagttttcagccatgcatgaattccagaacctgcactccatg
aacaaatccaagatccaggagttcgtaagaggacacttctatggtcatctggacttcaat
ctcgagaagacgctgttttttttcatcgctggacgatacgagttttctaataagggagca
gatctgtttctcgaatctctgtccagattaaactacttgctaagggttcataagagtgac
gttacagtggttgtgttttttatcatgcccgccaaaaccaacaactttaacgtggagtcg
cttaaaggacaggctgtacgcaagcaactgtgggacacggctcagtcggtgaaggagaag
tttggcaaaaagctttacgagagcttgttaaggggagaaatcccagacatgagcaaaatc
ctggacagagatgatttcaccatcatgaagagggccatttatgcaacacagcgacactct
cttcctccagtaacaactcacaacatgctggacgactccactgacccgatcctgggcaac
atccggcgtatcggcctcttcaatggacgcaacgacagagtaaagattgtgtttcatccc
gagttcctgtcctccaccagccccctgctgccaatggactatgaggagtttgtgcgcggc
tgccacctgggagtgttcccatcctactatgaaccatggggctacacaccaggtgagtgc
acagtcatgggaatccccagtgtgaccacaaatctatctgggtttggctgtttcatggag
gaacatgtttctgacccgtctgaatatggaatctacatcgtggaccggcggtttcgctct
gcggacgagtcgtgtaatcagctgacccagttcatgttttcattctgccagaagtcgcgc
aggcagagaataatccagcgtaaccgaacggagagactctctgatctgctggactggaga
tatcttggacgattctacatgcacgccagacatttggccctcagcagatccttccctgag
aaattccgaccggagcatctaaaccttacgtcgacgcagggtttccgttaccctcgacca
tcctctgttcctccgtctccgtcagcctccatccactccacccctcaccacagcgatgaa
gaggatgacgacacctatgatgaagaggaggaggccgagcgggacagactgaacatcaag
gccccgttcagtgtgggcgcagacaccgacggtaagaggacacaacccgtggaaaacggc
aattag

DBGET integrated database retrieval system