KEGG   Danio rerio (zebrafish): 373108Help
Entry
373108            CDS       T01004                                 

Gene name
xiap, birc4, fb73d01, wu:fb73d01, zgc:91873
Definition
X-linked inhibitor of apoptosis
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
dre  Danio rerio (zebrafish)
Pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:dre04120]
Cellular Processes; Cell growth and death; Apoptosis [PATH:dre04210]
Cellular Processes; Cell communication; Focal adhesion [PATH:dre04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
14
AA seq 405 aa AA seqDB search
MAHSTHNGELESDNVAADWSVMKNRVNSFQRFPYSEDISAQRLARAGFYFTGEGDRVQCF
SCSATVQNWNRGDTPLERHQLASPDCRFLSCAHGMRNSNSIQSPDYDEEAENREFLLRTG
EVVDESMYPVVPHMKSEEARLSTFNNWPADSPVRPEDLAEAGMYYIGIDDNVQCFCCGGG
LSGWEQGDDPWSEHAKYYSNCFFFLGHNVGNVPLTTPRPRVNVHPTDTFEGRLDSFKGRQ
HPIDPERLARAGFYSTGEQDRVMCFRCGGGVKAWMPDEDPWEEHARHYPGCSFLLAEKGE
EYVSSVQLRYPKRPTQNGFSSHESGSSAQALIHGSSDMFEKAEDPMTELEKLQREKLCKV
CMDSDISIVFIPCGHLVTCQKCSASLDKCPICCATITQKIKTYNA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcacactcaactcataatggcgaattggaatctgacaatgtggcagctgattggtca
gtcatgaagaatcgggtgaactcttttcaacgttttccatattctgaagacatttcagca
cagcggctggcccgagcaggcttttacttcacaggcgagggggacagggtgcaatgtttc
agctgcagtgccactgtgcagaactggaacagaggtgacaccccattggagagacatcaa
ctggcatctccggattgcaggttcctcagctgtgctcatggtatgagaaactctaattcg
atccagagtcctgattacgatgaagaggccgagaatagagagttcctcctccgcacggga
gaggtggtggacgagtccatgtatcctgttgtgccgcacatgaagagtgaagaagcgcga
ctgagtactttcaacaactggccagcagactctccagttcggcctgaagacctggcagaa
gcagggatgtattacattgggatagacgacaatgtgcagtgcttctgttgcggagggggt
ctgagtggatgggagcaaggcgacgatccttggagtgaacatgcgaagtactactcaaac
tgcttcttcttcttgggccacaatgtgggcaacgtccccctgacaacacctaggccaagg
gttaatgtccaccctacggacacttttgaggggcgtcttgatagcttcaaaggcagacag
catcccattgaccctgagagattggccagagctggtttctacagcacaggtgaacaagac
cgtgtgatgtgcttcagatgtggaggaggagtaaaggcatggatgcctgatgaagaccct
tgggaggaacatgccagacactatccaggttgcagtttccttctggcagaaaaaggagaa
gaatatgtcagcagtgttcaactgagatatccaaaaaggccaactcagaatggcttttca
agtcatgagagcggttcttcagcccaggcattaattcacggctccagtgacatgtttgag
aaagccgaagacccgatgacagaacttgagaaactccagagggagaagctctgcaaggtc
tgcatggacagtgacatcagcatcgtcttcattccctgcggacacctggtcacctgtcaa
aaatgttcagcgtccctagacaagtgtcccatctgctgtgctaccatcacacagaagata
aagacttacaatgcctaa

DBGET integrated database retrieval system