KEGG   Danio rerio (zebrafish): 373108Help
Entry
373108            CDS       T01004                                 

Gene name
xiap, birc4, fb73d01, wu:fb73d01, zgc:91873
Definition
(RefSeq) X-linked inhibitor of apoptosis
  KO
K04725  
E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
dre  Danio rerio (zebrafish)
Pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    373108 (xiap)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    373108 (xiap)
  Cellular community - eukaryotes
   04510 Focal adhesion
    373108 (xiap)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    373108 (xiap)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     373108 (xiap)
Ubiquitin system [BR:dre04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    373108 (xiap)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    373108 (xiap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
14
AA seq 405 aa AA seqDB search
MAHSTHNGELESDNVAADWSVMKNRVNSFQRFPYSEDISAQRLARAGFYFTGEGDRVQCF
SCSATVQNWNRGDTPLERHQLASPDCRFLSCAHGMRNSNSIQSPDYDEEAENREFLLRTG
EVVDESMYPVVPHMKSEEARLSTFNNWPADSPVRPEDLAEAGMYYIGIDDNVQCFCCGGG
LSGWEQGDDPWSEHAKYYSNCFFFLGHNVGNVPLTTPRPRVNVHPTDTFEGRLDSFKGRQ
HPIDPERLARAGFYSTGEQDRVMCFRCGGGVKAWMPDEDPWEEHARHYPGCSFLLAEKGE
EYVSSVQLRYPKRPTQNGFSSHESGSSAQALIHGSSDMFEKAEDPMTELEKLQREKLCKV
CMDSDISIVFIPCGHLVTCQKCSASLDKCPICCATITQKIKTYNA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcacactcaactcataatggcgaattggaatctgacaatgtggcagctgattggtca
gtcatgaagaatcgggtgaactcttttcaacgttttccatattctgaagacatttcagca
cagcggctggcccgagcaggcttttacttcacaggcgagggggacagggtgcaatgtttc
agctgcagtgccactgtgcagaactggaacagaggtgacaccccattggagagacatcaa
ctggcatctccggattgcaggttcctcagctgtgctcatggtatgagaaactctaattcg
atccagagtcctgattacgatgaagaggccgagaatagagagttcctcctccgcacggga
gaggtggtggacgagtccatgtatcctgttgtgccgcacatgaagagtgaagaagcgcga
ctgagtactttcaacaactggccagcagactctccagttcggcctgaagacctggcagaa
gcagggatgtattacattgggatagacgacaatgtgcagtgcttctgttgcggagggggt
ctgagtggatgggagcaaggcgacgatccttggagtgaacatgcgaagtactactcaaac
tgcttcttcttcttgggccacaatgtgggcaacgtccccctgacaacacctaggccaagg
gttaatgtccaccctacggacacttttgaggggcgtcttgatagcttcaaaggcagacag
catcccattgaccctgagagattggccagagctggtttctacagcacaggtgaacaagac
cgtgtgatgtgcttcagatgtggaggaggagtaaaggcatggatgcctgatgaagaccct
tgggaggaacatgccagacactatccaggttgcagtttccttctggcagaaaaaggagaa
gaatatgtcagcagtgttcaactgagatatccaaaaaggccaactcagaatggcttttca
agtcatgagagcggttcttcagcccaggcattaattcacggctccagtgacatgtttgag
aaagccgaagacccgatgacagaacttgagaaactccagagggagaagctctgcaaggtc
tgcatggacagtgacatcagcatcgtcttcattccctgcggacacctggtcacctgtcaa
aaatgttcagcgtccctagacaagtgtcccatctgctgtgctaccatcacacagaagata
aagacttacaatgcctaa

DBGET integrated database retrieval system