KEGG   Danio rerio (zebrafish): 373108Help
Entry
373108            CDS       T01004                                 

Gene name
xiap, birc4, fb73d01, wu:fb73d01, zgc:91873
Definition
X-linked inhibitor of apoptosis
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
dre  Danio rerio (zebrafish)
Pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    373108 (xiap)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    373108 (xiap)
  Cellular commiunity
   04510 Focal adhesion
    373108 (xiap)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    373108 (xiap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
14
AA seq 405 aa AA seqDB search
MAHSTHNGELESDNVAADWSVMKNRVNSFQRFPYSEDISAQRLARAGFYFTGEGDRVQCF
SCSATVQNWNRGDTPLERHQLASPDCRFLSCAHGMRNSNSIQSPDYDEEAENREFLLRTG
EVVDESMYPVVPHMKSEEARLSTFNNWPADSPVRPEDLAEAGMYYIGIDDNVQCFCCGGG
LSGWEQGDDPWSEHAKYYSNCFFFLGHNVGNVPLTTPRPRVNVHPTDTFEGRLDSFKGRQ
HPIDPERLARAGFYSTGEQDRVMCFRCGGGVKAWMPDEDPWEEHARHYPGCSFLLAEKGE
EYVSSVQLRYPKRPTQNGFSSHESGSSAQALIHGSSDMFEKAEDPMTELEKLQREKLCKV
CMDSDISIVFIPCGHLVTCQKCSASLDKCPICCATITQKIKTYNA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcacactcaactcataatggcgaattggaatctgacaatgtggcagctgattggtca
gtcatgaagaatcgggtgaactcttttcaacgttttccatattctgaagacatttcagca
cagcggctggcccgagcaggcttttacttcacaggcgagggggacagggtgcaatgtttc
agctgcagtgccactgtgcagaactggaacagaggtgacaccccattggagagacatcaa
ctggcatctccggattgcaggttcctcagctgtgctcatggtatgagaaactctaattcg
atccagagtcctgattacgatgaagaggccgagaatagagagttcctcctccgcacggga
gaggtggtggacgagtccatgtatcctgttgtgccgcacatgaagagtgaagaagcgcga
ctgagtactttcaacaactggccagcagactctccagttcggcctgaagacctggcagaa
gcagggatgtattacattgggatagacgacaatgtgcagtgcttctgttgcggagggggt
ctgagtggatgggagcaaggcgacgatccttggagtgaacatgcgaagtactactcaaac
tgcttcttcttcttgggccacaatgtgggcaacgtccccctgacaacacctaggccaagg
gttaatgtccaccctacggacacttttgaggggcgtcttgatagcttcaaaggcagacag
catcccattgaccctgagagattggccagagctggtttctacagcacaggtgaacaagac
cgtgtgatgtgcttcagatgtggaggaggagtaaaggcatggatgcctgatgaagaccct
tgggaggaacatgccagacactatccaggttgcagtttccttctggcagaaaaaggagaa
gaatatgtcagcagtgttcaactgagatatccaaaaaggccaactcagaatggcttttca
agtcatgagagcggttcttcagcccaggcattaattcacggctccagtgacatgtttgag
aaagccgaagacccgatgacagaacttgagaaactccagagggagaagctctgcaaggtc
tgcatggacagtgacatcagcatcgtcttcattccctgcggacacctggtcacctgtcaa
aaatgttcagcgtccctagacaagtgtcccatctgctgtgctaccatcacacagaagata
aagacttacaatgcctaa

DBGET integrated database retrieval system