KEGG   Danio rerio (zebrafish): 378446Help
Entry
378446            CDS       T01004                                 

Gene name
dhcr7
Definition
7-dehydrocholesterol reductase (EC:1.3.1.21)
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
dre  Danio rerio (zebrafish)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    378446 (dhcr7)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     378446 (dhcr7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
2
AA seq 478 aa AA seqDB search
MMASDRVRKRHKGSANGAQTVEKEPSKEPAQWGRAWEVDWFSLSGVILLLCFAPFLVSFF
IMACDQYQCSISHPLLDLYNGDATLFTIWNRAPSFTWAAAKIYAIWVTFQVVLYMCVPDF
LHKILPGYVGGVQDGARTPAGLINKYEVNGLQCWLITHVLWVLNAQHFHWFSPTIIIDNW
IPLLWCTNILGYAVSTFAFIKAYLFPTNPEDCKFTGNMFYNYMMGIEFNPRIGKWFDFKL
FFNGRPGIVAWTLINLSYAAKQQELYGYVTNSMILVNVLQAVYVVDFFWNEAWYLKTIDI
CHDHFGWYLGWGDCVWLPFLYTLQGLYLVYNPIQLSTPHAAGVLILGLVGYYIFRVTNHQ
KDLFRRTEGNCSIWGKKPTFIECSYQSADGAIHKSKLMTSGFWGVARHMNYTGDLMGSLA
YCLACGGNHLLPYFYIIYMTILLVHRCIRDEHRCSNKYGKDWERYTAAVSYRLLPNIF
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgatggcatctgacagggtgagaaagcgccataagggcagtgccaatggtgcccagaca
gtggagaaggagccatcaaaggagccggcgcagtggggaagagcatgggaggtggattgg
ttctctctttcgggtgtgatcctgctgctctgctttgcccccttccttgtctctttcttc
atcatggcatgtgatcagtaccagtgctccataagtcaccctctacttgatctctacaac
ggtgacgccaccctgttcaccatctggaaccgggctccttccttcacatgggctgctgca
aaaatctacgccatctgggtcacatttcaggtggtgctgtacatgtgtgttccagatttt
ctgcataagatccttccaggctacgtaggaggagttcaggatggtgcccgtacacctgca
ggtctgattaataaatatgaggtcaacggtcttcagtgctggctcatcactcatgtttta
tgggtgcttaacgctcagcacttccactggttttcgccaaccatcatcattgacaactgg
atccctctgttatggtgcaccaacatcctcggctatgctgtgtccacatttgctttcatt
aaagcgtatctgttccccaccaacccagaggactgtaaattcacaggcaacatgttctac
aactacatgatgggaattgagttcaatcctcgtataggaaaatggtttgacttcaagctt
ttttttaatggccggccgggtatcgtggcatggaccctcataaacttatcctatgcagct
aagcagcaggagctgtatggttacgtgacaaactctatgatcctggtcaacgttttgcag
gccgtctatgtagtggactttttctggaatgaagcctggtacctgaagactattgacatc
tgccatgatcattttggctggtatctgggctggggagactgtgtgtggctgcctttcctc
tacacacttcagggtctttacctggtctacaaccccatccagctctctacgccccacgca
gcaggggtcctcatcctgggtctggtgggctactacatcttccgcgtgaccaaccaccag
aaagaccttttccgtcgcactgagggcaactgcagcatctggggtaagaagcccaccttc
atcgagtgctcctaccaatcggccgacggtgcaattcacaagagcaaactcatgacctct
gggttttggggtgtggcgcgtcacatgaactacacgggcgacttgatgggctcgctggcg
tactgtttggcctgtggaggcaaccacctactgccgtatttctacatcatctacatgacc
atcctgctggtgcaccgctgcattcgggacgagcaccgctgtagcaacaaatacggcaag
gactgggagcgctacactgcggcagtttcctaccgcttactgcctaacatcttttag

DBGET integrated database retrieval system