KEGG   Danio rerio (zebrafish): 378851Help
Entry
378851            CDS       T01004                                 

Gene name
pdia3, Grp58, sb:cb825
Definition
protein disulfide isomerase family A, member 3 (EC:5.3.4.1)
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    378851 (pdia3)
Enzymes [BR:dre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     378851 (pdia3)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   378851 (pdia3)
  Exosomal proteins of colorectal cancer cells
   378851 (pdia3)
  Exosomal proteins of bladder cancer cells
   378851 (pdia3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
25
AA seq 494 aa AA seqDB search
MMLALLFLVAFAAAARASDVLEYTDDDFDSRIGDHDLILVEFFAPWCGHCKRLAPEYEAA
ATRLKGIVPLAKVDCTANSKVCGKYGVSGYPTLKIFRDGEDSGGYDGPRTADGIVSHLKK
QAGPASVELKNEADFEKYIGDRDASVVGFFADGGSAAQGEFLKAASALRESYRFAHTNNE
DLLKKHGIDGEGIILFRSPQLSNKFEDSSVLFTEDKFTSAKIKKFIQDNIFGICAHMTED
NKDQLKGKDLLVAYYDVDYEKNPKGSNYWRNRVMKVAKGFLDQGKKLSFAVANKNRFSHD
VSELGLDGSSGELPLVGIRTAKGDKYVMKEEFSRDGKALERFLQDYFDGNLKRYLKSEPV
PENNDGPVKVLVAENFDSIVNDDSKDVLIEFYAPWCGHCKSLEPKYKELGEKLSEDPNIV
IAKMDATANDVPSPYEVSGFPTIYFSPAGRKQNPKKYEGGREVSDFISYLKREATNTVVV
QEDKKKSKKKKSEL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgatgctggctttgctgtttctcgttgctttcgcagcggccgcgcgcgccagtgatgtg
ctcgagtacacagatgacgattttgacagcagaataggagaccacgatctcatcttggtg
gagttcttcgcaccctggtgtggtcactgcaagcgtcttgcccctgagtatgaggcagcc
gccactcgactgaaaggcattgtcccacttgctaaggtggactgtaccgccaattccaaa
gtgtgcggtaaatatggtgtaagcggatacccaaccctgaagattttcagagacggtgag
gactctggaggctatgatggtcccaggactgcagatggaattgttagccatctgaaaaag
caggctggtccagcttcggtggaactcaaaaatgaagctgattttgagaagtacattgga
gatcgtgatgctagtgttgtgggcttcttcgctgacggaggaagtgccgctcagggagag
tttctgaaggcagccagtgctttgagagagtcctaccgcttcgcccacactaacaatgag
gatctgttaaagaaacatggcattgatggagaaggtattattttgttccggtcaccgcaa
ctgagcaacaaatttgaagacagcagcgtgttgttcacagaagacaaattcacaagcgca
aagatcaagaagttcattcaggacaacatttttggcatctgtgcccacatgactgaggac
aacaaagaccagctgaaaggcaaagacttgttagtggcctactatgatgtggattatgag
aagaaccccaagggctcgaactactggaggaatagggtaatgaaagtggccaagggtttc
ctggatcaggggaagaaactgagtttcgctgtggccaataagaaccgcttcagccatgat
gtgtctgaactgggtctggacggcagcagtggagaacttcctctcgttggcattcgaaca
gccaaaggagacaaatacgtcatgaaggaggagttctctcgtgatggaaaggccttggag
aggttcctgcaggattattttgatggaaacctgaagcgttaccttaaatctgagcccgtt
cctgagaacaacgatggccctgtgaaggttcttgtggctgagaactttgactcgattgta
aacgatgacagtaaagacgttctcatcgagttttatgccccctggtgtggacactgcaag
agcctggagcccaaatataaagaactgggagagaagctttccgaagatccaaatatcgtc
attgcaaaaatggatgccaccgctaatgatgtcccctctccgtatgaagttagcgggttc
cccacaatctatttctccccagctggccgtaaacagaatccaaagaaatatgagggaggt
cgtgaagtgagcgacttcatttcctacctgaagagagaggccacaaacacagtggtcgtt
caagaggacaagaagaaatcaaaaaagaagaagagcgagttgtaa

DBGET integrated database retrieval system