KEGG   Danio rerio (zebrafish): 378960Help
Entry
378960            CDS       T01004                                 

Gene name
mgll
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    378960 (mgll)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     378960 (mgll)
Peptidases [BR:dre01002]
 Serine Peptidases
  Family S33
   378960 (mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
8
AA seq 300 aa AA seqDB search
MPEPEGTRRSPQGVPYSDLPHIVNADGLHLFCRYWEPDGPPKALVYVAHGAGEHCGGYAD
IAHSLTQHGILVFAHDHVGHGQSEGERMELKNFQIYVRDSLQHIDIMKARYPKLAVFIVG
HSMGGAISILTACERPQDFTGVVLIGPMVQMSAESATPFKVFMAKVLNRLAPKLTLGPID
PKFVSRDPKQVEAYEKDELNYHGGLRVSFGMQMLDATSRIERELPDIRWPFYILHGDADK
LCDIRGSRLLYNEAKSTDKKLKVYEEAYHALHHDLPETIESVLKEVSTWILERVPAPQTS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgccggaacccgaggggactcgtcggtcaccgcaaggtgttccttacagcgacctgccg
cacatcgtcaacgccgacggactgcacttgttctgtcgttactgggagcccgacggtcct
ccgaaggcgctggtgtatgttgcccatggagcgggagagcattgtgggggatacgctgac
attgctcacagtctgacccagcatggcattctggtgttcgcccacgaccacgttggtcat
ggtcaaagtgaaggtgagaggatggagctcaaaaacttccagatttacgtcagagactcc
ctccagcacattgacatcatgaaggctcggtatcccaagctggccgtcttcatcgttgga
cattcaatgggaggagccatttccattctgaccgcatgcgagaggccgcaggattttaca
ggtgtggttctcattggccctatggttcagatgagtgctgaatctgctacacccttcaag
gttttcatggccaaagttctaaaccgcttggctcctaaactcactctcggcccaatcgat
ccaaaatttgtctcacgggatcccaaacaggtggaggcatatgaaaaggatgagctgaat
tatcatggggggctacgcgtctcgttcgggatgcagatgttggatgcgacgtctcgcatc
gagagagagttaccagacatcaggtggcccttttacattctacatggagacgccgacaaa
ctgtgtgacatcagaggctctcgattattgtataatgaagccaagagcactgataaaaaa
ctgaaggtatatgaagaagcttaccatgccctacatcacgacttacctgaaacaatcgag
tctgtattaaaggaggtgagcacctggatcctggagagagtccctgcccctcaaacctct
tag

DBGET integrated database retrieval system