KEGG   Danio rerio (zebrafish): 386792Help
Entry
386792            CDS       T01004                                 

Gene name
padi2, sb:cb968, zgc:66317
Definition
peptidyl arginine deiminase, type II (EC:3.5.3.15)
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     386792 (padi2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
6
AA seq 647 aa AA seqDB search
MVSRRSLTIDTEKATKTTYVLGTTLTVNLIRCAPPQSKSFSIRCTPNVHYKITPPITDKN
ALPYPLGPNTILLITMDTVSETAFDSKLSVRYYGEKTETLGDAILHLTAVEISLDVDADR
DGVVEKNNPNKASWKWGPNGHGAILLVNCDSESINNKKPDNENSDIGKVSDLKDMSKMVL
RTNGPSQLPEGYKLSMHISQSTSESVRVFRPRTNTKTENLWKYQLLKLFLKDFLMVVGTD
TLTQEVPYLGGSSELEFHVEGLRFPDKDFDGLVTINLSLLEPCGKGFPETPIFTDKVVFR
VSPWIMTPNTLKPVEVYVCSTEDNYSFLKSIRNLVEKSGYKLKICHEYMNRGDRWMQDFP
YDALLGPDFGYVTRNALNEEVSSLDSFGNLEVSPPVTVNGKNYPLGRIIIGVAFPTARKG
RNMTKVVQDFLWAQKVQEPIALYSDWLFVGHVDEFMSFVPAPDRKKFRLLLASPDAGYKV
FKSLQNSGLGKAEMFPGKEEAISVNDLLSDKKLQAENRYVQNCIDWNRDVLKKELGLDDE
DIIDLPILFKVMEEKNEDSVPRAVAYYPDMVNMIVLGDQLGVPKPFGPQVKGVCALEKEM
CSLLEPLGLKCTFIDDFAPYHKLLGEVHCGSNVLREPFTVRWWNLEL
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcccgtcgatctcttactattgacaccgagaaagcgaccaagacgacatatgtg
ctcggaacgactttaacggtgaacttaatcagatgtgctccaccacaatccaagtccttc
tcaataagatgcaccccaaacgtgcattacaagataacacctccaatcacggacaagaac
gccctcccatatcccctcgggccaaacaccatcctcctcatcaccatggacacagtcagt
gaaactgcattcgacagcaagttgtctgtgagatactacggtgagaaaacggagacgctt
ggggacgccatactgcatctaacagctgttgagatatctctggatgtagatgctgaccga
gatggtgttgttgagaaaaacaatccaaacaaggcctcatggaaatggggtcctaatggc
catggtgcaattctgctggtcaactgtgactctgagtccataaacaacaagaaaccggac
aatgagaacagtgacattggtaaagtctcagatttgaaggacatgtccaagatggtgttg
cgcactaatggaccatctcaacttcctgaaggctataagctgagcatgcacatctcgcag
agcacttcagagagtgtcagagtctttagacctcgcacaaacacaaaaacagaaaacttg
tggaagtaccaactcctgaagctgttcctgaaggatttcctgatggtggtgggaacagac
acgctgacgcaggaagtgccatatttgggaggcagcagtgaactggagttccatgtagaa
ggtcttcgtttccctgataaagactttgatggactcgtcaccatcaacctcagtctgctc
gagccctgtgggaagggtttcccagagacgcccatctttacagataaagtggtttttcgt
gtctctccatggatcatgaccccaaacaccctaaagcctgtggaggtttatgtgtgcagc
actgaggataactactcattcttgaagagcataagaaatctggtggagaagagcggctac
aaactcaaaatatgtcatgaatacatgaaccgaggcgatcgctggatgcaggattttccc
tatgatgcccttctggggccagattttggatatgtgacgcgaaatgcgctgaatgaggag
gtgagcagcctggactctttcggtaatctggaggtcagtccaccagtcacagtgaatggg
aaaaactacccactcggcaggatcatcattggagtggcgttccctacagcaaggaaaggc
cgcaacatgactaaagttgtccaggacttcctgtgggcacagaaggttcaagagccaata
gcgctttactctgattggctgtttgtgggtcatgtggacgagttcatgagctttgttcca
gcccctgacagaaagaaattccgattgctgttggctagtcctgatgctggatacaaagtt
ttcaaaagcctacaaaatagcggacttggaaaagcagaaatgtttccaggtaaggaggag
gccatctctgtaaatgacctcctcagtgacaaaaagctgcaggctgaaaacagatacgtg
cagaactgtatcgactggaacagggacgtgctgaagaaagagctgggtctggatgatgag
gacatcattgacttgcccatcctctttaaagtgatggaagagaagaatgaggattcagtt
cccagggctgtggcgtattaccctgacatggtgaacatgatcgtgttgggtgatcagctg
ggtgtcccaaagccattcgggccacaggtgaagggtgtgtgtgcgctggagaaagaaatg
tgttctcttctggagcctctgggcctcaaatgcaccttcatcgacgatttcgccccgtat
cacaaactgctgggtgaagttcactgcgggtccaatgttctccgagaacctttcaccgtc
aggtggtggaacctggagctgtaa

DBGET integrated database retrieval system