KEGG   Danio rerio (zebrafish): 386920Help
Entry
386920            CDS       T01004                                 

Gene name
hist2h2l, fj05g08, wu:fj05g08, zgc:73093
Definition
histone 2, H2, like
Orthology
K11252  
histone H2B
Organism
dre  Danio rerio (zebrafish)
Brite
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   386920 (hist2h2l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
10
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKTQKKGDKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaacctgcgaagtcagcgcccgctcccaaaaaaggctctaaaaaagctgtcacc
aagacccagaagaagggggataagaaaaggcgtaagaccaggaaagagagttacgccatt
tacgtgtacaaagtactaaaacaagtccacccggacactggcatctcctcaaaggcgatg
ggcattatgaactcatttgtaaacgacatcttcgagcgcatcgccggagaagcgtcgcgc
ctggcgcattacaacaagcgctccactatcacatcccgggagatccagacggccgtgcgc
ctgctcctgcccggggaactggccaaacacgcagtgtctgagggcacaaaggccgtgacc
aaatacaccagctccaagtga

DBGET integrated database retrieval system