KEGG   Danio rerio (zebrafish): 387527Help
Entry
387527            CDS       T01004                                 

Gene name
cyp4t8, cb1041, cyp4
Definition
cytochrome P450, family 4, subfamily T, polypeptide 8
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     387527 (cyp4t8)
Cytochrome P450 [BR:dre00199]
 Cytochrome P450, animal type
  CYP4 family
   387527 (cyp4t8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
16
AA seq 458 aa AA seqDB search
MLLYGISPFVLSVNHVFALIFLACLLTVVKLLIVRRKGVKTMERFPGPPAHWLFGHVKEF
RQDGHDLEKIVKWMELYQFAFPLWFGPSLAVLNIHHPSYAKTILTTTEPKDDYAYKFFIP
WLGDGLLVSTGQKWFRHRRLLTPGFHYDVLKPYVKLISDSTKVMLDKWEVHSRSEESFEL
FKHVSLMTLDSIMKCAFSCNSNCQTDSGTNPYIQAVFDLCHLVNLRFRVFPYHSKAIFHL
SPHGYRFRKAASIAHNHTAEVIRKRKEVLKMEEEQGIVKNRRYLDFLDILLSARDEHQQG
LSDEDIRAEVDTFMFEGHDTTASGISWIFYNLACNPEHQEKCRQEIQQALDGKDTLEWED
LNKIPYTTMCIKESLRLHPPVPGISRKLTKPLTFFDGRTVPEGCTIGVSIYGIHMNSTVW
ENPYKFDPLRFLPENAANRSPHAFVPFSAGPRFVTRSV
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgctgctctacgggatttctccgtttgtgctctccgtcaatcatgtttttgcgctcatc
tttctggcgtgtttgctgacagtggtgaagttactgattgtgaggagaaagggggtgaaa
actatggagcgtttccctggacctcctgcacactggctctttggacacgttaaggagttc
cgccaggatggacatgatttagagaagatcgtcaagtggatggaactgtatcagtttgcc
ttccctctatggtttggcccgtcgttggctgttttgaacatccaccatccgtcatacgct
aagaccattctcacaacaacagaacccaaagatgactacgcatacaagtttttcatccca
tggttaggcgatggcttactggtgtccactggacagaaatggttccggcatagacgactg
ctcactcctggtttccattatgacgttttgaagccttacgtgaaacttatttctgattca
actaaagtcatgcttgataaatgggaagttcactccagatcagaagagtcctttgagctg
tttaagcatgtaagtctcatgacgctggacagcatcatgaaatgtgcattcagctgtaac
agcaactgtcagacagacagtggaaccaacccgtatatccaggcagtgtttgacctctgc
cacctggtgaacctcaggttcagagtgtttccgtaccacagcaaggccatatttcatctc
agtccacatggataccggttcaggaaggcagccagcattgcacacaatcacacagcggaa
gttatcagaaagaggaaagaagtcttgaagatggaggaggagcagggcattgttaaaaac
agacgatatttagactttctggatattcttctgtctgctcgagacgagcatcagcagggt
ttgtcagacgaggacatcagagctgaagtggacacgttcatgtttgagggccacgacacc
acggctagtggaatatcctggatcttctataatctggcttgtaatcccgagcaccaggag
aaatgcaggcaggagatccagcaagctctggatggaaaagacacgctggagtgggaagac
ctgaataaaattccatacaccacaatgtgcattaaagaatcactgcggcttcatcctcct
gtgccaggaatatcacggaagctgaccaaacccttgactttctttgatggacgaactgta
cctgaaggttgcaccattggagtcagcatttatgggatccacatgaattccacagtgtgg
gagaatccatataaatttgatcccctgaggtttttgcctgagaacgcagctaacaggtct
cctcatgcctttgtgcccttttctgctggacccaggtttgtaacccggagtgtttga

DBGET integrated database retrieval system