KEGG   Danio rerio (zebrafish): 393120Help
Entry
393120            CDS       T01004                                 

Gene name
josd2, zgc:55937
Definition
Josephin domain containing 2 (EC:3.4.19.12)
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     393120 (josd2)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C86
   393120 (josd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
16
AA seq 184 aa AA seqDB search
MSEGEVFHEKQRLELCAIHALNNVLQERVFTKETADDICKRLAPQCVMNPHRSVLGTGNY
DVNVIMAALQSRGLAAVWWDERRSVQNLCLDKIQGFILNVPSRVSLGIVSLPLRRRHWLA
VREVHGHFYNLDSKLKGPACIGGETELRSFLTEQLSQDVAEMLLVVQKEVDEDGTWLKPD
DTRK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagggcgaggtgtttcatgagaagcagagactggagctgtgcgccatccatgcc
ttgaacaacgtgcttcaggagagagttttcactaaagagaccgccgatgacatctgcaag
cgacttgccccgcagtgtgtaatgaatccacaccgctcagtgctgggcacgggaaactat
gatgtcaatgtcatcatggcagctttgcagagtcgaggactcgctgctgtctggtgggac
gagcgcaggtcagtacagaatttgtgcctggacaaaattcagggcttcattttgaatgtc
ccgtcaagggtgtcactgggaattgtgtctctcccactgagacggagacactggctggcg
gtacgagaggttcacggacacttctataacctagactccaaattaaaagggcctgcctgt
ataggtggagaaacagaactcaggtcatttcttactgaacagctctctcaggatgtagca
gagatgctcctcgtcgtccaaaaggaagtggacgaagatggaacatggctgaagcctgac
gacaccaggaagtga

DBGET integrated database retrieval system