KEGG   Danio rerio (zebrafish): 393227Help
Entry
393227            CDS       T01004                                 

Gene name
usp44, zgc:55661
Definition
ubiquitin specific peptidase 44 (EC:3.4.19.12)
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     393227 (usp44)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   393227 (usp44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
4
AA seq 695 aa AA seqDB search
MDRCKHVGRLRLAQDHSILNPQKWHCVDCNTTESVWACLSCSHVACGRYIEEHALQHFKE
QHHPLALEVNELYVYCYLCDDYVLNDNATGDLKLLRSTLSAIKSQCYEVTTRSGRTLRSS
SANGDQLSPSTQELQLRDEDRMFTALWHRRRALIGRLFRLWFAQTERGKKRLEEERQQEE
EEERKREARERRRQLKRQLKEELESAPPRKSHRIRRQSLKATSVKPARAPAKSTKSVRRR
SAPARVSTPTPRTPRERTPQQRPRPQAKAKRPQAPPSKTGDSPVKRRPTVTPGVTGLRNL
GNTCYMNSILQVLSHLHVFRECFLRLDLNQALELLASAVSRKLGLSAQRVIQPKGLNQGS
GLSGGASRSRNMELIQPKEPSSKHISLCHELHTLFPVMWSGKWALVSPFAMLHSVWQLIP
AFRGYAQQDAQEFLCELLDKVQHELERTRTLTPATVPANQRRLIKQVLSVVNTIFHGQLL
SQVRCLACDHRSNTIEPFWDLSLEFPERYHSNSKDAAQVPCGLTEMLAKFTETEALEGAI
YACDYCNNKRRRFCSKQVVLTEAQKQLMVHKLPHVLRLHLKRFRWSGRNHREKIGVHVQF
EQELNMEPYCCKDSGNLPHPQHFLYQLSAVVMHHGKGFGSGHYTAFCYNTEGGFWVHCND
SKLSVCAVEEVCKAQAYILFYTQRNAQDKSKESDL
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggacaggtgtaagcacgtgggtcgcttaaggcttgcgcaggaccactcgatcctgaac
ccgcagaaatggcactgtgtggactgcaacaccaccgagtcggtgtgggcatgtcttagc
tgttctcatgtagcatgtggacgctacatagaggaacatgcgcttcagcactttaaggag
cagcaccaccctttggccctggaggtgaatgagttgtatgtgtactgctacttgtgtgat
gactacgtgctgaatgataatgcgacaggtgacttaaagctgttgcgaagcacgttaagt
gctattaagagccagtgctatgaagtcaccacacgtagtggccgtacccttcgctcatcc
tctgctaatggagatcagctatcgcctagcacgcaggagctgcagttgcgggatgaggac
cgcatgttcactgcattgtggcaccgccggcgtgctctaatcggtcgcctttttcgcctg
tggttcgcacaaactgaacggggaaagaagcgtttggaggaggaacggcaacaggaggaa
gaggaggagaggaagcgtgaagcacgggaaagaagacggcaactcaaacggcagctcaag
gaagagttggaaagtgcacctcctaggaagagccatcgcattcgacgacagagcttgaag
gcaacttctgtgaaacccgcaagagcaccagccaaaagcactaaatctgtgaggcgcagg
tctgctcctgctcgcgtctccactcctactccacgaactcctagagagagaactcctcaa
cagaggccccgtccacaagccaaggccaaacggccacaggctccaccttctaaaacaggc
gattcgcccgtcaaacggcgacctactgtaactccaggagtgacaggtttgcgcaacctt
ggcaatacttgctacatgaactcgatattgcaggttctgagtcacttgcatgtattccga
gagtgctttttgagactggatctgaaccaagcgctggaactgctagcctctgcggtcagc
cgcaagttaggactctctgctcagcgcgtgatccagcccaaaggccttaatcaggggtcc
ggactcagtggaggggcctcccgttcacgcaacatggagctcatacaacccaaggagccc
agctccaaacatatctcgctttgtcacgaattacacacactctttccggtgatgtggtca
ggcaagtgggctctggtttccccatttgcaatgctgcattctgtgtggcagctgattcca
gcgttccgaggttatgcacagcaggatgcacaggaatttctttgtgaacttttagataaa
gtccagcatgagctggaacggaccagaacattaacacctgccactgttccggccaaccag
agacgccttatcaaacaggtgctcagtgtggtcaataccatctttcatggccagctcctc
agtcaggtgaggtgtttagcatgcgatcatcgctcaaacacaattgagcccttctgggat
ctttctctggaattccctgaacgataccacagcaacagtaaggatgctgcacaagttcct
tgtggcttgacagagatgctggctaagtttacagagactgaggcattggaaggagccata
tatgcttgtgactactgcaacaacaaacgacggcgattctgttcgaagcaggtggtcttg
actgaagctcagaaacagctgatggttcacaaactgcctcatgttctcagattgcacctc
aaacgattcaggtggtccggtcgaaaccacagggagaagatcggtgttcatgttcagttt
gagcaggagctgaacatggagccgtattgctgcaaagactccggcaacttaccccatcct
caacactttctctaccaactttctgctgtcgtcatgcatcacgggaagggtttcggatca
ggccattacactgccttttgttataatactgaaggagggttttgggtgcactgtaatgac
tctaaactgagtgtctgcgcggtggaggaagtgtgtaaggcccaggcctacattctcttt
tacacgcagagaaacgctcaggacaaaagcaaagagagtgacctctga

DBGET integrated database retrieval system