KEGG   Danio rerio (zebrafish): 393417Help
Entry
393417            CDS       T01004                                 

Gene name
capn1a
Definition
(RefSeq) calpain-11
  KO
K01367  
calpain-1 [EC:3.4.22.52]
Organism
dre  Danio rerio (zebrafish)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Necroptosis
Cellular senescence
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    393417 (capn1a)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    393417 (capn1a)
   04217 Necroptosis
    393417 (capn1a)
   04218 Cellular senescence
    393417 (capn1a)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     393417 (capn1a)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C2: calpain family
   393417 (capn1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
13
AA seq 704 aa AA seqDB search
MFSYGGISAHISANRLKADGAGSFEQALHFQNQDYEALRQECLEGGYLFEDPCFPAEPPS
LGFKELAPHSSKTRDVEWMRPTELCDDPQFIVGGATRTDICQGALGDCWLLAAIGSLTLN
ERLLHRVVPHGQSFQDDYAGIFHFQFWQFGEWVDIVIDDRLPVKDGELMFVHSAEGNEFW
SALVEKAYAKLNGSYEALSGGSTTEGFEDFTGGVSEMYELRKAPRDLYRIISKALDRGSL
LGCSIDITSAFDMESVTFKKLVKGHAYSVTALKQVEYRGRMERLIRIRNPWGQVEWTGAW
SDNSPEWDEIDPSEKDDLHLQMEDGEFWMSFGEFLRQFSRLEICNLTPDALSDDDMSHWN
TIKFHGAWRRGSTAGGCRNHPNTFWINPQYKITLLEEDDDPEDEEVACSFLVALMQKDRR
RYRGQGQDMHTIGFAIYEVPEEYTGCQNVHLKKDFFLSNSSAARSETFINLREVSTRLRL
PPGEYIIVPSTFEPSKEADFVLRVFTEKQSETEELDDEISADLEDEEEITEDDIDDSFKS
LFAQLAGEDMEISVHELKTILNRVVSKHKDVKTDGFSMDSCRTMVNLLDKDGSARLGLVE
FQILWNKIRKLLGIFREFDIDKSGTMSSYEMRLAVESAGFKLNNRLNQILVARYAENEAI
DFDNFVCCLIKLEAMFRSFQQLDREETGTAEMNLSEWLFMTMCG
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgttctcatacggcgggatctcagcacacatcagcgctaacagactgaaggcggatggc
gcaggttcttttgagcaggctttacacttccagaaccaggactacgaggccctcagacag
gagtgtttagagggaggctacctgtttgaagacccctgtttcccagccgaaccgccctct
ctgggcttcaaagagctcgccccgcactcctccaaaacccgagatgtggagtggatgcgc
cctacggagctctgtgatgatcctcagttcattgttggaggagccacacgcacagacatc
tgtcaaggagctctgggtgactgctggctcctcgctgcgattggctcgctgactcttaat
gaaagactccttcacagggttgtccctcatggccagagctttcaagatgactatgctgga
attttccactttcagttctggcagttcggtgaatgggtggacattgtgatcgatgatcgg
ctcccggtcaaagacggagagctcatgtttgtccattcagcagagggaaatgagttctgg
agtgccttggtggaaaaagcctatgctaagctaaatggctcttatgaagctctttctgga
ggctctaccactgagggttttgaggattttactggaggcgtttcagagatgtacgagctc
cggaaagctcccagagacttgtaccgaatcatcagcaaagccctggacagaggctcactg
ctgggctgctctattgatatcaccagtgcctttgacatggagtctgtgacatttaagaag
ctggtaaagggtcacgcttactccgtgactgctctcaaacaggtggagtacagggggcgg
atggagaggcttatccgcatccgtaatccatggggtcaggtagaatggaccggagcctgg
agtgataactctcctgaatgggatgagattgatccatcagagaaggacgacttgcactta
caaatggaggatggagagttttggatgtcatttggtgagtttttacgtcagttctcccgg
ctggagatttgcaatctgacccctgatgctctgagtgacgatgatatgagccactggaac
accatcaagtttcatggagcctggaggagaggaagcactgcaggaggatgccgaaatcat
cccaacacgttctggatcaatccacagtataagattacactgctggaggaagatgatgat
ccggaggatgaagaagtggcctgcagcttcctggtggctttaatgcagaaagaccgcaga
cggtaccgcggccaaggacaagatatgcacactatcgggtttgcaatttatgaggttcct
gaagagtacacaggctgtcagaacgtgcaccttaagaaggatttcttcttgagcaactca
tcagctgctcgatccgagaccttcatcaacctgcgggaggtgagcactcgcctgcgtctg
cctcctggagaatacatcatcgtcccctccaccttcgagcccagcaaagaggccgatttt
gtcctgagagtcttcacggagaaacagtccgagaccgaggaattggatgacgagatttca
gctgacctggaggatgaggaagaaattacagaagatgacattgatgactcctttaagtcc
ctgtttgcccagctggctggagaggatatggagatatctgttcatgaactcaagactatt
ctcaacagagtagtctccaaacacaaagatgtgaagacagacggcttcagcatggactcc
tgcagaacgatggtcaacctcctggataaagatgggagcgcacgtttgggcttagtagag
tttcagatcctctggaacaaaataaggaagttgctggggatcttcagagagtttgatatt
gataagtcaggaactatgagctcttatgagatgcgtctcgctgtagaatcagcaggcttt
aaactcaataacagactcaaccagatcctggtagccagatatgcagagaacgaggccatt
gattttgataacttcgtctgctgcttgatcaaactagaggccatgttcagatcttttcaa
cagctggacagagaagaaacaggaacggctgagatgaacctttctgagtggctcttcatg
accatgtgtggttga

DBGET integrated database retrieval system