KEGG   Danio rerio (zebrafish): 393556Help
Entry
393556            CDS       T01004                                 

Gene name
gstt1b, zgc:65964
Definition
glutathione S-transferase theta 1b
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    393556 (gstt1b)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    393556 (gstt1b)
   00982 Drug metabolism - cytochrome P450
    393556 (gstt1b)
Enzymes [BR:dre01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     393556 (gstt1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
21
AA seq 242 aa AA seqDB search
MTLEIYLDLFSQPCRSVYIFAKKNNIQFDYKKISLFEGYQYGEEFGKINPLRKFPTIKDG
DFCLAESVAIMIYLADKFHTPDHWFPADLQKRARVNEYLSWQHTSIRMHGAKIIWFKILI
PEVLGAEVPKEKMENAEENLNVALQLFQDKFLQDKPFIVGDQISLADLVAIVEIMQPFAA
GMDVFENRPKLKAWKDRVRVAIGAKLFDEAHQATMSLRDNAKIIDPKGLSPLKDKILKYF
LS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactctggaaatttacttggacctgttttcccagccctgtcgctctgtgtacatcttt
gctaagaaaaacaacatccagttcgactacaagaagatttctctgtttgaaggttatcaa
tatggtgaagaatttggaaaaatcaacccactaagaaaattcccaacaatcaaagatgga
gacttttgcttagctgaaagtgtcgcgattatgatctacctggctgacaaattccacact
ccagaccattggtttccagcggacttgcagaagcgagctagagtaaatgaatatctgtcg
tggcagcacacttccattcggatgcatggagctaagattatctggtttaagatcttgatt
cctgaagtgctgggagctgaggtccctaaagaaaagatggagaacgcagaagagaatctg
aatgtggcactgcagctctttcaggataagtttctgcaagacaaaccgttcattgttggt
gatcagatctcattggctgatttggttgctattgtggaaatcatgcagccgtttgctgct
ggtatggatgtgtttgagaacagacccaagctcaaggcgtggaaagaccgagtcagagta
gcgatcggggctaagctgtttgatgaggctcatcaggcaaccatgtccttgcgggacaat
gccaaaatcattgatcccaaagggttgagtccattgaaagacaagattttgaagtatttc
ctctcataa

DBGET integrated database retrieval system