KEGG   Danio rerio (zebrafish): 393580Help
Entry
393580            CDS       T01004                                 

Gene name
bcmo1l, bcmo1b, zgc:63614
Definition
beta-carotene 15,15'-monooxygenase 1-like (EC:1.14.99.36)
Orthology
K00515  
beta-carotene 15,15'-monooxygenase [EC:1.14.99.36]
Organism
dre  Danio rerio (zebrafish)
Pathway
Retinol metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:dre00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
Un
AA seq 525 aa AA seqDB search
MLSFFWRNGIETPEPLKADVSGSIPPWLQGTLLRNGPGLFSVGNTSYKHWFDGMALIHSF
TFKDGEVFYRSKYLKSETYKKNIAADRIVVSEFGTMVYPDPCKNIFSRAFSYMMNAIPDF
TDNNLINIIKYGEDYYASSEVNYINQIDPLTLETLGRTNYRNHIAINLATAHPHYDEEGN
TYNMGTAIMNLGRPKYVIFKVPANTSDKENKKPALSEVEQVCSIPIRPSLYPSYFHSFGM
TENYIIFVEQAFKLDIVKLATAYFRDINWGSCLKFDQDDINVFHLVNKKTGKAVSVKYYT
DPFVTFHHINAYEDDGHVVFDLITYKDSKLYDMFYIQNMKQDVKRFIETNKDFAQPVCQR
FVLPVNVDKETPQDINLVKLQDTTATAVLKEDGSVYCTPDIIFKGLELPAINYKFNSKKN
RYFYGTRVEWSPYPNKVAKVDVVTRTHKIWTEEECYPSEPVFIASPDAVDEDDGVILSSV
VSFNPQRPPFLVVLDAKSFKEIARATIDASIHMDLHGLFIHDKST
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcttttttctggagaaacggaatagagacaccagagcccctaaaggcggacgtg
tcaggctctatcccaccatggcttcaggggacacttctgcgcaatggtcctggtctgttc
tcagttggcaacacttcatacaagcactggtttgatggaatggcgctcattcacagcttc
acatttaaagatggggaagttttttatcgaagtaaatacttgaagagtgaaacatacaaa
aagaacatcgctgccgacaggatcgttgtgtctgagtttggaacaatggtgtaccctgat
ccctgcaagaatatattctccagagccttcagttacatgatgaacgccattccagatttt
acagataacaatctcattaacatcataaaatacggtgaagattattatgcatcatcggag
gtcaactacatcaaccaaattgacccactgacacttgaaacgctaggacgaactaactac
agaaaccacattgccatcaacttggcaaccgctcaccctcactatgacgaggaagggaac
acatacaacatgggcacagcgatcatgaacctcggcagacccaaatatgtgattttcaag
gtgcctgccaatacctcagataaggaaaataagaagccagccctcagcgaggtggaacaa
gtttgctccattcccatccgcccctccttgtatccaagctacttccacagctttggcatg
acggagaactacatcatcttcgtagagcaggccttcaaactagacatcgtcaaactggct
acagcttacttcagagatatcaactggggaagctgcctaaaattcgaccaagatgacatt
aatgtgttccatctggtcaataagaagactgggaaggcagtgagcgtgaagtactacacg
gacccgtttgtgaccttccaccacatcaatgcttatgaggacgatggccacgtcgtcttt
gatctgattacatacaaggacagtaagctgtatgatatgttctacatacaaaacatgaag
caagacgtcaaaaggtttatagagaccaacaaggacttcgctcaaccagtgtgccagcgg
tttgtccttcccgtcaacgtagataaggaaacaccacaagacatcaacctagtcaagttg
caggacacaacagccacagcggtcctgaaagaggacggctctgtctactgcacccctgac
atcatttttaagggtttagagttgccagctatcaactacaaatttaacagtaagaagaac
aggtacttctatggcaccagggtggagtggtcaccatatccaaacaaggtcgcaaaagtg
gatgtagttaccaggacacataagatttggacagaggaggaatgttacccatctgagcca
gtgtttatagcctccccagacgccgttgatgaagatgacggtgtgattctttcttctgtg
gtttcattcaatccccaaaggccacctttcctggtggtcctggatgctaagtccttcaaa
gagattgctcgcgctaccatcgatgccagtattcatatggacttgcatggccttttcatc
catgacaaatctacctaa

DBGET integrated database retrieval system