KEGG   Danio rerio (zebrafish): 393697Help
Entry
393697            CDS       T01004                                 

Gene name
guk1b
Definition
(RefSeq) guanylate kinase 1b
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre01100  Metabolic pathways
Module
dre_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    393697 (guk1b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     393697 (guk1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_18 ABC_tran RsgA_GTPase AAA_22 NACHT MMR_HSR1 cobW RNA_helicase AAA_29 AAA_14 dNK AAA_17 AAA_28 AAA_23 AAA_30 AAA Rad17 DUF815 AAA_24 AAA_5 NTPase_1 KAP_NTPase Roc
Motif
Other DBs
NCBI-GeneID: 393697
NCBI-ProteinID: NP_957018
ZFIN: ZDB-GENE-020916-1
Ensembl: ENSDARG00000005776
Vega: OTTDARG00000027050
UniProt: Q6PC32
Position
8
AA seq 223 aa AA seqDB search
MSGPRPVVLSGPSGAGKSTLLKRLMKEYEGVFGFSVSHTTRNPRPGEEDGKGLNCLPMLL
GATLLPVADVLSSVTSEDYHFVTKEKMQEGIDKDEFIENAEFSGNMYGTSKSSIEDVQAQ
NLICILDVDIQGVRNIKKTDLNPIYISIQPPSMEILEKRLRDRQTETEDSLQKRLEAARI
DMELSKEPGVFDIVIVNDDLEEAYEKLKSVLIEEIEKVQDAQK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtctggacccagaccggtagttttgagtggcccgtcaggagctgggaaaagcaccctg
ttgaagagactcatgaaagaatatgaaggggtgtttggtttcagcgtctctcacaccacc
agaaatcctcggccgggagaggaagatggaaaagggctgaattgtctcccaatgcttctg
ggggctacattacttcctgtagcggacgtcctgtcctctgtgacatctgaagattaccac
tttgtcaccaaagagaagatgcaagaaggaattgacaaggacgagttcattgagaatgca
gagttttcaggaaatatgtatggaaccagcaaatcatccattgaggatgtccaggcacaa
aacctcatctgcatcttggatgttgacatacaaggagtgagaaacatcaagaagactgat
ctgaaccccatatacatctccatccaaccaccttcaatggagatcctggaaaagcgtctg
agggacagacaaacggagacagaggatagtctacagaagcgactggaagcagcgaggatt
gacatggagctcagtaaggaacctggagtatttgatattgtaatcgttaatgatgacctg
gaagaagcctatgagaaactcaaaagtgttcttattgaggaaattgagaaggttcaagat
gcccagaaatag

DBGET integrated database retrieval system