KEGG   Danio rerio (zebrafish): 393697Help
Entry
393697            CDS       T01004                                 

Gene name
guk1b, guk1, zgc:73128, zgc:73217
Definition
guanylate kinase 1b (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dre  Danio rerio (zebrafish)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    393697 (guk1b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     393697 (guk1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
8
AA seq 223 aa AA seqDB search
MSGPRPVVLSGPSGAGKSTLLKRLMKEYEGVFGFSVSHTTRNPRPGEEDGKGLNCLPMLL
GATLLPVADVLSSVTSEDYHFVTKEKMQEGIDKDEFIENAEFSGNMYGTSKSSIEDVQAQ
NLICILDVDIQGVRNIKKTDLNPIYISIQPPSMEILEKRLRDRQTETEDSLQKRLEAARI
DMELSKEPGVFDIVIVNDDLEEAYEKLKSVLIEEIEKVQDAQK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtctggacccagaccggtagttttgagtggcccgtcaggagctgggaaaagcaccctg
ttgaagagactcatgaaagaatatgaaggggtgtttggtttcagcgtctctcacaccacc
agaaatcctcggccgggagaggaagatggaaaagggctgaattgtctcccaatgcttctg
ggggctacattacttcctgtagcggacgtcctgtcctctgtgacatctgaagattaccac
tttgtcaccaaagagaagatgcaagaaggaattgacaaggacgagttcattgagaatgca
gagttttcaggaaatatgtatggaaccagcaaatcatccattgaggatgtccaggcacaa
aacctcatctgcatcttggatgttgacatacaaggagtgagaaacatcaagaagactgat
ctgaaccccatatacatctccatccaaccaccttcaatggagatcctggaaaagcgtctg
agggacagacaaacggagacagaggatagtctacagaagcgactggaagcagcgaggatt
gacatggagctcagtaaggaacctggagtatttgatattgtaatcgttaatgatgacctg
gaagaagcctatgagaaactcaaaagtgttcttattgaggaaattgagaaggttcaagat
gcccagaaatag

DBGET integrated database retrieval system