KEGG   Danio rerio (zebrafish): 393722Help
Entry
393722            CDS       T01004                                 

Gene name
lypla2, zgc:73210
Definition
lysophospholipase II (EC:3.1.1.5)
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    393722 (lypla2)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     393722 (lypla2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
19
AA seq 232 aa AA seqDB search
MCGNNMSVPLLAEAVTVPGTEKETAVVIFLHGLGDTGHGWADAMTSIRLPYIKYICPHAP
RIPVTLNLKMTMPSWFDLMGLSPESPEDEAGIKRAAENIKAIIDHEVKNGIPSNRIVLGG
FSQGGALSLYTALTSQQQLAGVVGLSCWLPLHKTFPQAAGASANKDTPILQCHGEMDPMI
PVQFGAMTAEKLKTIVSPENITFRTYPGLMHSSCPQEMSAVKDFIEKQLPRV
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcaacaacatgtctgtacccctgctcgctgaagccgtgacggtgcctgggacg
gagaaggagacggctgtggtgatcttccttcatggcttgggcgatacaggacacggctgg
gctgatgccatgacatcgattcgactgccgtacatcaaatacatctgcccacatgcgccc
agaatccctgtaacgctcaacttgaagatgaccatgccgtcatggtttgatctgatgggc
ttaagcccggaatcaccggaggatgaagcagggattaagagagcagcagagaacataaaa
gccatcatcgatcacgaggtaaagaacggtataccatccaatcgtattgtcctcgggggc
ttctctcagggtggagctctgtctctctacaccgctctgacctctcagcagcagctcgct
ggcgtcgtcggacttagctgttggcttccccttcataagactttcccacaggctgcaggt
gcgagtgcaaacaaggacactcccattcttcagtgtcacggtgagatggatcccatgatc
ccggtgcagtttggggccatgacagcagagaagctcaagaccattgtgtctccagagaat
atcaccttccgcacctacccgggtctcatgcacagctcctgtcctcaggagatgtctgct
gtgaaggacttcattgaaaagcagttgcccagagtctga

DBGET integrated database retrieval system