KEGG   Danio rerio (zebrafish): 393732Help
Entry
393732            CDS       T01004                                 

Gene name
eif4e2rs1, eIF4E2B, zgc:73242
Definition
eukaryotic translation initiation factor 4E family member 2 related sequence 1
Orthology
K03259  
translation initiation factor 4E
Organism
dre  Danio rerio (zebrafish)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    393732 (eif4e2rs1)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    393732 (eif4e2rs1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    393732 (eif4e2rs1)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     393732 (eif4e2rs1)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     393732 (eif4e2rs1)
Translation factors [BR:dre03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    393732 (eif4e2rs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
23
AA seq 228 aa AA seqDB search
MNQFEHLKEEDCGDHEEMKDNNESDRASINNNNNNIRRKMVTPAAGEHPLQYNYTFWYSR
RTPSRPANTQSYEQNIRQMGTVASVEQFWKFYSHLVRPGDLTGHSDFHLFKEGIKPMWED
EANKNGGKWIIRLRKGLASRFWENIILAMLGEQFMVGEEICGVVVSIRFQEDILSIWNKT
ANDQVTTSRIRDTLRRVLNLPPNTIMEYKTHNDSLKDNSSFRNTKITL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagtttgaacatttaaaggaggaagactgtggcgaccatgaggagatgaaggac
aataatgagagcgatagagcttcaataaacaacaacaataacaacatcagacgcaagatg
gtgactccggctgcaggtgaacacccgctgcagtataactacacgttctggtactcgcgc
cggacgcccagcagacctgctaacacacagagctacgagcagaacatccggcagatggga
accgtggcctcggtggagcagttttggaagttctacagtcatctcgtccgacctggagat
ctgacaggacacagcgacttccacctgttcaaagagggaatcaaacccatgtgggaggac
gaggccaataagaatggagggaagtggatcatccgtctgagaaagggtctggcgtctcgt
ttttgggagaacatcatcctggccatgctgggcgagcagttcatggtgggcgaggagatc
tgcggggtggtcgtgtccatccgctttcaggaggatattctgtccatctggaataaaaca
gccaatgatcaggtgaccacatcacggatacgggacaccctgcggcgcgtgctcaacctg
ccgccaaacaccatcatggagtacaagacacacaacgacagtctgaaggataactccagc
ttccggaacacgaagatcactttgtga

DBGET integrated database retrieval system