KEGG   Danio rerio (zebrafish): 393732Help
Entry
393732            CDS       T01004                                 

Gene name
eif4e2rs1, eIF4E2B, zgc:73242
Definition
eukaryotic translation initiation factor 4E family member 2 related sequence 1
Orthology
K03259  
translation initiation factor 4E
Organism
dre  Danio rerio (zebrafish)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:dre03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dre04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:dre04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
23
AA seq 228 aa AA seqDB search
MNQFEHLKEEDCGDHEEMKDNNESDRASINNNNNNIRRKMVTPAAGEHPLQYNYTFWYSR
RTPSRPANTQSYEQNIRQMGTVASVEQFWKFYSHLVRPGDLTGHSDFHLFKEGIKPMWED
EANKNGGKWIIRLRKGLASRFWENIILAMLGEQFMVGEEICGVVVSIRFQEDILSIWNKT
ANDQVTTSRIRDTLRRVLNLPPNTIMEYKTHNDSLKDNSSFRNTKITL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagtttgaacatttaaaggaggaagactgtggcgaccatgaggagatgaaggac
aataatgagagcgatagagcttcaataaacaacaacaataacaacatcagacgcaagatg
gtgactccggctgcaggtgaacacccgctgcagtataactacacgttctggtactcgcgc
cggacgcccagcagacctgctaacacacagagctacgagcagaacatccggcagatggga
accgtggcctcggtggagcagttttggaagttctacagtcatctcgtccgacctggagat
ctgacaggacacagcgacttccacctgttcaaagagggaatcaaacccatgtgggaggac
gaggccaataagaatggagggaagtggatcatccgtctgagaaagggtctggcgtctcgt
ttttgggagaacatcatcctggccatgctgggcgagcagttcatggtgggcgaggagatc
tgcggggtggtcgtgtccatccgctttcaggaggatattctgtccatctggaataaaaca
gccaatgatcaggtgaccacatcacggatacgggacaccctgcggcgcgtgctcaacctg
ccgccaaacaccatcatggagtacaagacacacaacgacagtctgaaggataactccagc
ttccggaacacgaagatcactttgtga

DBGET integrated database retrieval system