KEGG   Danio rerio (zebrafish): 393741Help
Entry
393741            CDS       T01004                                 

Gene name
pcmtl, zgc:73268
Definition
l-isoaspartyl protein carboxyl methyltransferase, like (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     393741 (pcmtl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
17
AA seq 228 aa AA seqDB search
MAWMSSGKTHVELITRLRDHGVIHNDRVFNAMLATDRGIYSRDHPYADSPQSIGYKATIS
APHMHAHALEVLSDKLTEGASALDVGSGSGYLTACFARMVGPSGKVVGIDHIDQLVQSSV
KNVQADDPELLATGRIKLVVGDGRFGFPDEAPYDAIHVGAAAPTLPKALLEQLKPGGRLV
LPVGPEGGSQVLEQYDRQSDGTFLRKPLMGVVYVPLTDKQHQWPGDEL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcatggatgtctagtggcaaaacacatgtagaactcatcactcgcttgagagatcat
ggagtcattcacaacgacagagtgtttaatgccatgcttgccactgatcgagggatttat
tccagagaccacccgtacgctgactctcctcagtccataggatacaaggctacaatcagt
gcccctcatatgcatgcacatgctcttgaggtcctcagtgataagttaacagaaggagcc
tcagcgctggatgtggggtctggaagtggatatctcactgcctgctttgccagaatggtt
ggaccatctggaaaagtagtgggaatagaccacatagatcaactggtgcagtcctctgtg
aaaaatgtccaggcagacgacccagaattacttgcaactggacgaattaaattagtggtg
ggtgatggacgctttggttttcctgatgaagccccatatgatgccattcatgttggagca
gctgctcctacactcccgaaagctctcctggaacagctgaagccaggtgggagacttgtt
ttgcctgtgggcccagagggtggaagccaagttctggagcagtacgaccgacagagcgat
ggcacgttcctcagaaaacctctgatgggagtggtttatgtcccactgacagacaagcaa
caccagtggccgggcgatgagctctga

DBGET integrated database retrieval system