KEGG   Danio rerio (zebrafish): 393759Help
Entry
393759            CDS       T01004                                 

Gene name
xrcc4, zgc:73312
Definition
X-ray repair complementing defective repair in Chinese hamster cells 4
Orthology
K10886  
DNA-repair protein XRCC4
Organism
dre  Danio rerio (zebrafish)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    393759 (xrcc4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
10
AA seq 357 aa AA seqDB search
MRCRSSSVRQISISSEPQRCFFLKLEWAEDLGSGFVIFLCDGESAWSGEVSEEDVSREAR
EMEMERDRYVCDLQLALTGAPSGSGASDEGEFTFQLTPERPGRPQLQLSYEKVQKDISFR
LGVVDLQPVPEPTEVIRELITHGLEQSSRLQASNQHLLEENQKLRREQQHITEEMERYVK
GKEALERDLYSRFVLVLNEKKAKLRALQQRVRELEEAEEERSPRKKKADSEDHEAVEAAA
DKSPDEESDYGGSTEDEQEAEPKRLDPKPPTEEMPECSPMDDSLNDITDVAPCRKRRHRH
LQQLEAQAKRKTLEQQHRSREKPVEETKAATSRTSSVPVKPANTAANLDPDELFDDI
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaggtgtcgcagcagtagtgtgcgtcagatctccatctcctctgagcctcagcgctgt
ttcttcctcaagttggaatgggctgaagatctcggctccggcttcgtcatctttctgtgt
gatggggaatctgcctggagcggtgaagtttccgaggaggacgtgtcgcgggaggctcgt
gagatggagatggagcgtgatcggtatgtctgtgacctgcagctggccctgaccggagca
ccatcaggatctggagcttcagatgagggtgaatttaccttccagctgacacctgagcgg
cccggacgaccccaactgcagctgtcttatgagaaggtgcagaaggacatctcgttcagg
ctgggcgtggtggatctgcagccggtgccggagcccactgaagtcatccgggagctcatt
actcacggcctggagcaaagctcacgtcttcaggcctcaaaccagcacctgttggaggag
aaccagaagctgaggagagaacagcagcacatcactgaagagatggaacgatacgtgaag
ggaaaggaggcgttagagagagacctgtacagccgctttgtgctggtcctcaatgagaag
aaagccaaactccgagccctgcagcagagggtccgagagctggaggaggctgaggaggag
agatcaccgagaaagaaaaaggcagatagtgaagatcatgaagcggtggaggcggcagca
gataagagtcctgatgaagagagtgattatggaggaagtacggaagatgaacaggaagca
gaacccaaacgcctcgacccaaaacctcctacagaagagatgccagaatgcagcccgatg
gatgacagtctgaatgacatcacagacgtggctccgtgccgtaaacgccgccatcggcac
ctgcagcaactcgaggctcaagccaaacgcaaaacgctggagcagcagcacagatccaga
gagaagccggtggaagaaaccaaagctgcgaccagcagaacgtcaagtgtcccggtgaag
cctgcaaacactgctgcaaaccttgatccagatgagctgtttgatgatatatga

DBGET integrated database retrieval system