KEGG   Danio rerio (zebrafish): 393962Help
Entry
393962            CDS       T01004                                 

Gene name
usp20, im:7151955, zgc:63661
Definition
ubiquitin specific peptidase 20 (EC:3.4.19.12)
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     393962 (usp20)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   393962 (usp20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
5
AA seq 913 aa AA seqDB search
MTDSGDLCPHLDSIGEVTKEELIQKSKGTCQSCGVGGPNLWACLQCDCPYVGCGESYSDH
STIHAQAKKHNLTVNLTTFRVWCYVCEREVFLEPKPVTPVSSAHRCKPHDQDPVLQTTCY
PLKAVPIAVADEEGSESEEDELKPRGLTGMKNIGNSCYMNAALQALSNCPPLTQFFQDCS
GLVRTDKKPALCKSYQKLISELWHKKRPSYVVPTTLFHGIKLVNPMFRGYAQQDTQEFLR
CLMDQLHEELKEPLFDCSGGISEVEPDLSLDSCNLVDGDRSPSEDEFLSCDSGSGSERGD
GERAGGEAELLIQDECVAVRGTGGISEKERLKERRGEERTREMDEDADVDTAAQDGQAER
ETETATPATAVPAPGNTEPDNEASMHCPSSRPCSPAHSVQELHSRLSSNPPRSSPLRTGP
TYTFKKAQILLSTKKKKQSRFRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIP
GKEDLAKLHSSIHQSAPVKAGVCTDGYAAQGWISYIMDSIRRFVVSCIPSWFWGPMVTLE
DCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKIN
SHVSFPLEGLDLKPFLAKESPSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFD
DQYVTEVHETVVQNAEAYVLFYRKSSEESVRERQRVVALANLKEPSLLQFYISREWLNKF
NTFTEPGPITNHTFLCQHGGTRIPPTKYHYVDDLVVILPQNVWEYLYNRFGGGPAVNHLY
VCAICQVEIETLAKRRKLEIDTFIKLNKEFQAEEAPTVILCISMQWFREWENFVKGKDNE
PPGPIDNSKIAVMKGGHIQLKQGADYGQISEETWQYLLSIYGGGPEIAVRQTISPPDTDT
HGERKIEAETRAL
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgactgacagcggggatctttgtcctcacttggactcgattggtgaagttactaaagaa
gaactgattcagaaatcaaagggcacgtgtcagtcatgtggagtaggtggaccaaatctc
tgggcatgtctgcagtgtgactgtccttatgtaggctgtggagagtcgtattcagaccac
agtactattcatgcacaggccaaaaagcacaatctgacagtaaacctgaccacatttagg
gtgtggtgttatgtctgcgaaagagaggtgtttctggagccaaagcctgttactcctgta
tcatcagctcaccgctgcaaaccacatgaccaggatcctgttttgcagactacatgttac
ccattgaaggcggtgcctatcgcagtggcagatgaggagggctcagagtctgaggaggat
gagctaaaacctagaggtctgacagggatgaaaaacattggaaactcttgttatatgaat
gctgcactgcaggccttgtccaactgtcctcctttgactcagtttttccaggattgcagt
ggattggtgcgtacggataagaagccggcattgtgtaaaagctatcagaagcttatctct
gaactctggcacaagaaacggccgagttatgttgtgccaactactctgtttcatggaatc
aaactggtgaaccccatgtttcgtggctatgctcaacaggacactcaggagtttttgcga
tgtctgatggaccagcttcacgaggagctgaaggagcctttgtttgactgcagcggtggc
atctctgaagtcgagcctgacctcagtctggacagctgtaatcttgtggacggagaccga
agcccctctgaagacgaattcctgtcgtgtgactctggatcaggaagcgaaaggggagat
ggagagcgtgcaggaggagaagcagagctgctcattcaagatgaatgtgtggcagtgaga
ggaaccggaggcatctcggagaaagagaggctgaaggagagaagaggagaagagaggaca
cgtgaaatggatgaggatgcagatgtggacacagctgcacaagacggacaggctgaaaga
gaaactgaaacagcgacaccagccacagctgtgccggcaccaggaaacacagaacctgat
aatgaagcttccatgcactgtccatcctctcgcccttgtagccccgctcacagtgtacag
gagcttcactccagactctctagtaacccaccaagatccagccctctcagaactggaccc
acgtatactttcaagaaagctcagattctactgagcaccaagaagaagaagcagtcccgt
ttccgtagtgttatttccgatatctttgatggatccattctgagtcttgttcagtgtttg
acatgtgaccgggtttcgacaactgtggagacgtttcaggacctttctttgcctataccc
ggtaaagaagatttggctaagcttcattcctccattcaccagagtgcacctgtgaaagct
ggtgtctgcactgatggctatgctgcacagggctggatctcctacatcatggactctata
cgaaggtttgtagtgtcctgtattccaagttggttttggggccccatggtaacgctagag
gactgtctggcagctttctttgctgctgatgagctgaaaggagacaacatgtatagctgt
gaacggtgtaaaaaattaagaaatggtgtgaaatattgtaaagttctgcgtctaccagaa
atattgtgcattcacctgaagcgcttcagacatgaagtcatgtactcgttcaaaataaat
agccacgtgtcattcccattggagggtttggatctcaaaccgttcctggctaaggaaagc
ccgtcccagattactacctatgacctgctgtctgtcatctgtcatcacggcactgctgga
agtgggcattacatagcgtactgccagaatgtgatcaatggacagtggtacgagtttgac
gatcagtatgtaacagaagtgcacgagactgtagtccagaatgctgaagcatatgtccta
ttctacaggaagagcagtgaagaatctgtgagagaaagacaaagggttgtcgctctggct
aatttgaaggagcccagtttgctgcagttctacatctccagagagtggctcaacaaattc
aacacattcactgagcccggacccatcaccaatcacactttcctttgtcagcacggaggt
actcgaattcctcctacaaagtaccattatgtggatgatctggttgtgatccttcctcaa
aatgtgtgggaatatctctacaacaggtttggaggtggcccggctgtgaatcacttatat
gtgtgtgcaatttgccaagtggagatcgagaccttagccaaacgacggaaactggagata
gacaccttcattaagttaaataaggagtttcaggctgaagaagctcctaccgtcatcctt
tgtataagcatgcagtggttcagagaatgggagaactttgtcaagggcaaagacaatgag
ccaccaggccccattgacaacagcaagattgcagtaatgaaaggcggtcatatccagctt
aaacaaggagcagactatgggcagatatctgaagaaacgtggcagtacttgttaagtatt
tatggcggtgggccagagattgcagtgcggcaaaccatcagccccccagacactgacaca
cacggggagaggaaaatagaggcagagaccagagccctctga

DBGET integrated database retrieval system