KEGG   Danio rerio (zebrafish): 393973Help
Entry
393973            CDS       T01004                                 

Gene name
rae1, zgc:56449, zgc:77723
Definition
ribonucleic acid export 1
Orthology
K14298  
mRNA export factor
Organism
dre  Danio rerio (zebrafish)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    393973 (rae1)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     393973 (rae1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
6
AA seq 368 aa AA seqDB search
MSLFGTNTGFGSGGTGVFGSTTTDSHNPMKDVEVTSPPDESISCLAFSPPTMPGNFLIGG
SWANDVRCWEVQDNGQTVPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQA
IQIAQHEGPIRTIHWIKAPNYSCIMTGSWDKTLKFWDTRSPNPMMSLQMPERCYCADVVY
PMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQSKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTATPQDIYAVNAISFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPITACCFNHNGNIFAYASSYDWSKGHEYYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgtttgggacaaacacgggctttgggtctggagggaccggtgtatttggcagt
accaccacagacagccataatccaatgaaggatgttgaagtaacttcgccacccgatgag
agcataagctgcttggcatttagtcctcctacgatgcctgggaactttctcatcggaggt
tcgtgggccaatgacgtacggtgttgggaagtgcaagataatggtcagactgtccctaaa
gcccaacagatgcacactggcccagtactggatgtgtgctggagtgatgatggtagtaaa
gtctttacagcttcttgtgataaaactgccaagatgtgggatctgaacagcaatcaggcc
attcagatagctcaacatgaaggtccaatcaggacaattcactggattaaagcaccaaac
tacagctgtattatgactggcagttgggacaaaactttgaagttttgggatacacgttcc
ccaaacccaatgatgtccctccagatgccagagaggtgttattgtgccgatgtggtatat
cccatggctgttgtagccactgcagaacgtggtcttattgtttatcagttagaaaatcag
ccttcagagtttcgacgtatagagtcacctcttaagcatcagcaccgctgtgtggctatc
tttaaggacaaacagagtaagcctactggatttgccctgggcagcattgagggacgagtt
gccattcattacataaatccacctaacccagccaaggacaatttcacctttaagtgccac
aggtccaatggaaccaatactgccacaccccaagatatctatgctgtgaatgctatctcc
tttcaccctgtccatggcacactggcgacagtaggctctgatgggcgcttcagtttctgg
gataaagatgcccgtactaagctgaagacttctgaacaattagatcaaccaataacagct
tgttgcttcaatcacaatgggaatatatttgcctatgcatcaagttatgactggtccaag
ggacatgaatattacaatccccagaaaaagaattacatcttcttgcggaatgcagctgag
gaactgaaaccacggaacaagaaatga

DBGET integrated database retrieval system