KEGG   Danio rerio (zebrafish): 393982Help
Entry
393982            CDS       T01004                                 

Gene name
alpl, Akp2, alp, zgc:56672
Definition
alkaline phosphatase, liver/bone/kidney (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dre00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
11
AA seq 451 aa AA seqDB search
MWECGCFLVLWSELSVVWHPWNVKIRKRRLIDNKMKVAQLLILSCLVWEGKTKVQFPEQE
KRPDYWRDFAQRSLKDALKLQELNKNIAKNIILFLGDGMGVPTVTAARILKGQLSGQNGE
ETQLEMDKFPHVALSKTYNTNAQVPDSAGTATAFLCGVKANEGTVGVSAAAVRSQCNTTQ
GNEVTSILKWAKDAGKSVGIVTTTRVNHATPSAAYAHCVDRDWYSDADMPNEALQSGCKD
IARQLFENIPDINVIMGGGRRSMYPKNTPDVEYPGDKKQNGTRKDGRNLVGEWIDRVKEK
RGYYVWNKKDLLSLNPNNVDYLLGLFEPADLNYELERNTENDPSLTEMVDVAIKILKKNE
RGFFLLVEGGRIDHGHHGSSSSRRPGAALHPSRHGLRRLHRPEQRPLPDKLGLFFILQSH
FSSTALSSLGQMAALLTLLLLLRCLQIKNFP
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaatgtggatgctttcttgttctgtggagcgagctttcagttgtctggcaccct
tggaacgtgaaaatccgtaaacgcaggctgatagataacaaaatgaaggtcgcacaactg
cttatcctcagctgtctggtttgggagggaaagacaaaagttcagtttccagagcaagag
aagcggcctgattactggagggactttgctcaacgctcacttaaagatgccttgaagctt
caagaactcaacaagaacattgccaaaaacatcatcttatttcttggagatgggatgggt
gttcctacagtcacagcagcccggattttaaagggtcagttgagtggacagaacggagag
gaaacacaactggaaatggacaaatttccccacgtcgccctctctaagacgtataacacc
aatgctcaggtaccagacagcgcgggcactgccacagctttcctctgcggtgtcaaagcc
aacgagggcacggtgggagtgagcgcagcagctgtgagatcccaatgcaacaccactcag
gggaacgaggtcacctccattcttaaatgggctaaagacgcaggcaaatcagtgggaatc
gtcacaacaacgcgagtgaaccatgccaccccgagtgctgcttatgcccactgtgtggat
cgagactggtattctgatgcagacatgcccaatgaagcactgcagagcggatgcaaagac
atcgccagacaactctttgaaaacatccctgacattaacgtgataatggggggtgggcgg
agaagcatgtaccccaaaaacaccccagacgtggaatatccaggagacaagaaacagaat
ggtacacgcaaagatggcaggaaccttgtgggggagtggattgacagagtgaaagagaag
agaggttactacgtttggaacaagaaggatctcctttccctcaatcccaataacgtggat
tatctattgggtttgttcgagccagcagacctgaactacgagctggagagaaacacagaa
aatgacccttcgctcactgagatggtggatgtggccattaagatcctcaaaaaaaatgag
cgtggattcttcttgctggtggaaggtggacgcattgaccacggacaccatggctcatct
tcttcacggcgtccaggagcagcactacatccctcacgtcatggcctacgccgcctgcat
cggccagaacaaagaccactgccggacaaactcgggctcttcttcatacttcagtcacat
ttctccagcactgctctttcctctcttggtcaaatggctgctttgctgacccttcttctc
ttattaagatgtcttcagatcaagaactttccttaa

DBGET integrated database retrieval system