KEGG   Danio rerio (zebrafish): 393998Help
Entry
393998            CDS       T01004                                 

Gene name
prkacba, Prkacb, zgc:64054
Definition
protein kinase, cAMP-dependent, catalytic, beta a
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Apoptosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Gap junction
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    393998 (prkacba)
   04310 Wnt signaling pathway
    393998 (prkacba)
   04340 Hedgehog signaling pathway
    393998 (prkacba)
   04020 Calcium signaling pathway
    393998 (prkacba)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    393998 (prkacba)
   04210 Apoptosis
    393998 (prkacba)
  Cell communication
   04540 Gap junction
    393998 (prkacba)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    393998 (prkacba)
   04912 GnRH signaling pathway
    393998 (prkacba)
   04914 Progesterone-mediated oocyte maturation
    393998 (prkacba)
   04916 Melanogenesis
    393998 (prkacba)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    393998 (prkacba)
   04270 Vascular smooth muscle contraction
    393998 (prkacba)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     393998 (prkacba)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   393998 (prkacba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
11
AA seq 395 aa AA seqDB search
MAQPKDPHFGHSSGTNSALQKLDTLASRFFYKCRKGNHDKGLENEGPHVSEHTVLWDTAM
KETLAKAKEDFLNKWECQQKSTACLDDFDKLKTLGTGSFGRVMLVKHKQSEQYFAMKILD
KLKVVKLKQIEHTLNEKKILQAVSFPFLVKLECAFKDNSNLYMVMRYIQGGEMFSHLRRI
GRFSEQNARFYAAQIVLTFEYLHMLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRT
WTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKV
RYPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKNHRWFASTDWIAIYEKKVDAPII
PKCRGPGDTSNFDEYDEEVIRVSVSEQCSKEFLDF
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcccagccaaaggatccacactttggccattcatcaggcactaactctgcccttcag
aagctggacactttagctagccgttttttttacaaatgtcgaaaaggaaaccatgacaaa
ggactggagaatgaggggccgcatgtgtcagagcacactgtcctttgggatacagcaatg
aaggaaactctggcaaaagctaaagaggatttcttgaacaaatgggagtgccagcaaaag
agcacagcatgtctagatgactttgacaaactgaaaactctcggcactggatcttttgga
cgagtaatgcttgttaaacacaaacagtcagaacagtattttgcaatgaagattctggac
aaactaaaagtggtgaagctgaaacagattgaacacacattaaacgagaagaaaatatta
caagcggtctcctttcctttccttgtaaaacttgagtgcgcttttaaggataattcaaat
ttatacatggtcatgagatatatccaaggtggtgagatgttctcacatttgagaaggatt
ggaagattcagtgaacagaatgcacgtttctatgcggctcagattgttctgacgtttgag
tatcttcacatgctggacctcatctacagggacctgaaacctgaaaacctgctcattgat
catcagggatacattcaggtaacagattttggatttgccaaaagagtcaaaggcagaact
tggacattgtgtggaacaccagaatacctggcaccagaaatcattctcagcaagggctac
aacaaggctgttgactggtgggcactgggtgttctgatctatgaaatggctgctggatat
ccgcctttcttcgctgatcagcctattcagatttatgagaaaatcgtgtctggcaaggta
cgatacccctcacacttcagctcagacttgaaggaccttttacgcaatctactgcaagtg
gacctcacaaagcgctttggcaatttgaaaaatggagtcagtgacattaaaaaccacaga
tggttcgcttccacagactggattgcaatctatgagaagaaggtggatgcacccatcata
ccaaagtgcagagggcctggcgacacgagtaactttgacgaatatgacgaagaagtcata
cgggtatctgtctcagagcaatgttcaaaagaattcttggacttctag

DBGET integrated database retrieval system