KEGG   Danio rerio (zebrafish): 394138Help
Entry
394138            CDS       T01004                                 

Gene name
asns, zgc:56605, zgc:76901
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dre  Danio rerio (zebrafish)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    394138 (asns)
Enzymes [BR:dre01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     394138 (asns)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C44
   394138 (asns)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
19
AA seq 560 aa AA seqDB search
MCGIWALFGSDECLSVQCTNAMKIFHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLYGMQ
PLRVKKFPYLWLCYNGEIYNHIKLKNHFEFDYQTKVDGEILLHLYDRFGIEKMCSLLDGV
FAFILLDTANRKVNLGRDTYGVRPLFRMLTDDGFLAVCSEGKGLTQIKHSMPTAKITAFP
PGHFEVFDLKLNGKVESVQMDRFHCCTDKPKHADFNKLEGLGTDFELETVKSNIRILFED
AVRKRLMAHRRIGCLLSGGLDSSLVAALLVKLAKEEKLPYPIQTFSIGAEDSPDVAAARK
VADYIGSEHHVVNFTPEEGISALEDVIVHLESYDITTVRASVGMYLVSKYIREKTDSVVI
FSGEGSDELTQGYIYFHKAPSPKAGAEDSVRLLEELYLFDVLRADRTTAAHGLELRVPFL
DHRFTAYYLSLPEEMRVPKNGVEKHLLRDAFDGMNLIPDEILWRRKEAFSDGLTSVKKSW
YTSLQEHIESELNDSQLENANKLYHINPPTTKEGLFIRQIFEKHYPGQGEWTPHYWMPRW
IKATDPSARTLSIYKPDKEQ
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatatgggccttgtttggtagtgatgagtgcctttcagttcagtgcactaat
gccatgaagatctttcatcgtggaccggatgctttccgcttcgagaatgtcaacggtttc
actaactgctgctttgggtttcaccgtcttgcgattgttgaccagctttatggcatgcag
cctctgcgagtcaaaaagttcccttatctgtggttatgttacaacggtgaaatctacaac
cacatcaagctgaagaatcactttgagtttgactatcaaaccaaagtagatggtgagatc
cttctgcatctgtacgatcgctttggaatcgagaagatgtgctccctgctggatggtgtg
ttcgccttcatcttattagacacagctaacagaaaggttaacttgggaagagatacatac
ggcgtgagaccgctattcagaatgctgactgacgatggttttctagctgtctgttctgaa
ggcaaaggtctaacacaaatcaaacactccatgcccactgcaaagatcactgcttttcca
ccgggacactttgaggtgtttgacttgaagctcaatgggaaagtggagtctgttcagatg
gatcgctttcactgctgcacagacaaacccaaacatgctgactttaacaaactcgaggga
ctgggcacagacttcgaattggagacagtcaagagcaacattaggatcctgtttgaggat
gcagtaaggaaacgcttgatggctcacagaagaatcggttgccttctctcaggtggtctc
gactcaagtctggttgctgctttgcttgtgaaactggccaaagaagagaagcttccatat
cccattcagactttttccattggtgctgaggacagtccagatgtcgctgctgctcgcaag
gtggcagactacattggcagcgagcaccatgtggtaaactttacaccagaggaaggcatc
agtgcgctggaggatgtcatcgttcacttagagagttatgacatcaccactgttcgtgcc
tctgttggaatgtacctggtatcaaaatacatccgagagaagacagacagtgtggtgatt
ttctcaggtgaaggttcagatgagctgactcaaggatacatctactttcataaggctcca
tcacctaaagctggtgcagaggacagtgtgcgtctgctggaagagctttatctgttcgat
gtgctgagagccgacagaaccactgctgctcatggactggagttgagagtgcctttcctg
gaccacaggttcacagcatactacctctctctgcctgaagagatgagagtgcctaagaat
ggtgtggagaagcatcttttgagggatgcatttgatgggatgaacctgattcctgatgag
atcctttggagaaggaaagaggctttcagtgacggtttgacatcagtgaagaaatcgtgg
tacaccagcctacaggagcacatcgagtctgagctgaatgactctcagttggagaatgct
aataaactgtaccatatcaatcctcccacaaccaaagagggcttgttcatcagacagatc
tttgagaagcattaccctggccaaggtgagtggacgccacattactggatgccccgctgg
atcaaggccacagacccttcagccagaacactgtccatctacaagcctgataaagagcag
taa

DBGET integrated database retrieval system