KEGG   Danio rerio (zebrafish): 394155Help
Entry
394155            CDS       T01004                                 

Gene name
gys1, zgc:63701
Definition
(RefSeq) glycogen synthase 1 (muscle) (EC:2.4.1.11)
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    394155 (gys1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    394155 (gys1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    394155 (gys1)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     394155 (gys1)
Glycosyltransferases [BR:dre01003]
 Polysaccharide
  Storage polysaccharide
   394155 (gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
3
AA seq 700 aa AA seqDB search
MPLARSLSVTSLSGLDDWDEEFDREDAVLFEIAWEVANKVGGIYTVIQTKARLTCEEWGE
NYFLVGPYMESNVRTQVELIEPCNAALRRTIDKMNSSGCKVYFGRWLIEGSPYVVLLDVG
FTAWSLDRWKSELWEKCNIGVPWFDREANDAVLFGFLTAWLLGEYAAQCDEPPHIVAHFH
EWLAGLGLVLCRQRQLPVSTIFTTHATLLGRYLCAGNVDFYNNLAEFNVDKEAGDRQIYH
RYCLERAACRCAHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTVFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSEV
TVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQSVKERFGKKLYESLLVGQLPDVSKML
DKEDFTMMKRAIFATQRQCQPPVCTHNMLEDSSDPILNCIRRIGLFNSAQDRVKVIFHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRYRSVDESCNQLTSFLFQFCQQSRRQRIIQRNRTERLSDLLDWRY
LGRYYVSARHLALAKAYPDTYIYEPQEPSSAAGFRYPRPASVPPSPAHSLHSSPHHSEAE
DEEEPYDEDLEAEKDRVNIRQPYNLPNRNKNQTVGLPEKN
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgccactggcgcgcagtttatcggtcacctccttgtctggcctagatgactgggatgaa
gagtttgaccgggaggatgcagtcctgtttgagattgcatgggaggtcgctaataaagtt
ggtggcatttacacggtgatccagaccaaggcgcgtctgacctgcgaggaatggggcgag
aactactttctggtgggcccgtacatggagtccaatgtcaggacgcaagtggagctgatc
gaaccctgcaatgcggcactcaggagaaccattgataaaatgaacagcagcggctgcaag
gtttattttggtcgatggcttattgaaggctcaccatatgtggttctgctggacgtgggc
ttcacggcctggtctctggaccgctggaaaagtgaattgtgggagaaatgtaatattggt
gtgccttggtttgatagagaggcaaacgacgctgttctctttggcttcctcacagcttgg
cttctgggagagtatgcagctcagtgtgacgaacctcctcatattgtggcacattttcac
gagtggctggcaggtttgggtctcgtcttatgcaggcagcgacaactacctgtatcaact
attttcaccacacacgctactctcctcggccgatacctgtgtgctggaaacgtcgacttc
tacaacaacctggcagagttcaatgtggataaggaagcaggggaccggcagatctatcat
cgctactgtctggagcgagcagcttgccgatgtgcacacgtcttcaccacagtctctcag
atcaccgccattgaggctgagcacctgctaaagagaaaaccagatattgtgacaccaaat
ggcctaaatgtgaagaagttctcagccatgcatgagttccagaacctccatgctcagagt
aaagcacgcatccaggagttcgtcagaggccatttctatgggcatttagattttaacctt
gacaagacggtgtttcttttcattgctggacgctatgagttctcgaataaaggagcggat
atctttcttgaagctttggccagacttaattacctactgagggtgaatcacagcgaggtg
accgtcatagcatttttcattatgccggctcgcaccaacaacttcaatgtggagaccctg
aagggccaagccgtacggaaacagctctgggacactgcacagagtgtgaaagagcgcttt
gggaagaaactctatgaatcgcttttagtagggcagttgcctgatgtgtccaagatgttg
gataaggaggactttaccatgatgaagcgtgccatctttgccacccagcggcaatgccag
ccccccgtctgcacacacaacatgctggaggatagcagcgaccccatcctcaactgcatc
cgccgcatcggcctcttcaactcagctcaggacagagtcaaagtgatcttccatccagag
tttctctcctcaacttctcctctcttgccgatggactatgaggagtttgtgcgaggctgc
caccttggagtatttccctcttactatgaaccctggggatacacaccagccgagtgtacg
gtgatgggcatcccgtcaatctccactaacctgtctgggtttggctgttttatggaggag
cacattgcagacccatcagcttatggtatctatattctggaccggcggtatcgctcagtg
gatgagtcctgtaatcagctgacatcgttcttgtttcagttctgtcagcagagtcgcagg
caaaggatcattcaaaggaaccgaacagagcgcctcagtgacctgctggactggagatat
ctgggccggtattacgtttctgcccgtcatttggctttagcaaaggcttacccggacaca
tacatctatgaacctcaagaaccctcttcggccgcaggcttccgttatccgcgtcccgcc
tcagtgcctccttcccctgcccactcgcttcactcgtctcctcatcacagcgaggccgag
gatgaggaggaaccatacgatgaagatctggaggctgagaaagatcgagtcaacatccgc
cagccatacaacttacccaacaggaataagaatcaaacagttggtcttcctgagaagaat
taa

DBGET integrated database retrieval system