KEGG   Danio rerio (zebrafish): 394155Help
Entry
394155            CDS       T01004                                 

Gene name
gys1, zgc:63701
Definition
glycogen synthase 1 (muscle) (EC:2.4.1.11)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    394155 (gys1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    394155 (gys1)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     394155 (gys1)
Glycosyltransferases [BR:dre01003]
 Polysaccharide
  Storage polysaccharide
   394155 (gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
3
AA seq 700 aa AA seqDB search
MPLARSLSVTSLSGLDDWDEEFDREDAVLFEIAWEVANKVGGIYTVIQTKARLTCEEWGE
NYFLVGPYMESNVRTQVELIEPCNAALRRTIDKMNSSGCKVYFGRWLIEGSPYVVLLDVG
FTAWSLDRWKSELWEKCNIGVPWFDREANDAVLFGFLTAWLLGEYAAQCDEPPHIVAHFH
EWLAGLGLVLCRQRQLPVSTIFTTHATLLGRYLCAGNVDFYNNLAEFNVDKEAGDRQIYH
RYCLERAACRCAHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTVFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSEV
TVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQSVKERFGKKLYESLLVGQLPDVSKML
DKEDFTMMKRAIFATQRQCQPPVCTHNMLEDSSDPILNCIRRIGLFNSAQDRVKVIFHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRYRSVDESCNQLTSFLFQFCQQSRRQRIIQRNRTERLSDLLDWRY
LGRYYVSARHLALAKAYPDTYIYEPQEPSSAAGFRYPRPASVPPSPAHSLHSSPHHSEAE
DEEEPYDEDLEAEKDRVNIRQPYNLPNRNKNQTVGLPEKN
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgccactggcgcgcagtttatcggtcacctccttgtctggcctagatgactgggatgaa
gagtttgaccgggaggatgcagtcctgtttgagattgcatgggaggtcgctaataaagtt
ggtggcatttacacggtgatccagaccaaggcgcgtctgacctgcgaggaatggggcgag
aactactttctggtgggcccgtacatggagtccaatgtcaggacgcaagtggagctgatc
gaaccctgcaatgcggcactcaggagaaccattgataaaatgaacagcagcggctgcaag
gtttattttggtcgatggcttattgaaggctcaccatatgtggttctgctggacgtgggc
ttcacggcctggtctctggaccgctggaaaagtgaattgtgggagaaatgtaatattggt
gtgccttggtttgatagagaggcaaacgacgctgttctctttggcttcctcacagcttgg
cttctgggagagtatgcagctcagtgtgacgaacctcctcatattgtggcacattttcac
gagtggctggcaggtttgggtctcgtcttatgcaggcagcgacaactacctgtatcaact
attttcaccacacacgctactctcctcggccgatacctgtgtgctggaaacgtcgacttc
tacaacaacctggcagagttcaatgtggataaggaagcaggggaccggcagatctatcat
cgctactgtctggagcgagcagcttgccgatgtgcacacgtcttcaccacagtctctcag
atcaccgccattgaggctgagcacctgctaaagagaaaaccagatattgtgacaccaaat
ggcctaaatgtgaagaagttctcagccatgcatgagttccagaacctccatgctcagagt
aaagcacgcatccaggagttcgtcagaggccatttctatgggcatttagattttaacctt
gacaagacggtgtttcttttcattgctggacgctatgagttctcgaataaaggagcggat
atctttcttgaagctttggccagacttaattacctactgagggtgaatcacagcgaggtg
accgtcatagcatttttcattatgccggctcgcaccaacaacttcaatgtggagaccctg
aagggccaagccgtacggaaacagctctgggacactgcacagagtgtgaaagagcgcttt
gggaagaaactctatgaatcgcttttagtagggcagttgcctgatgtgtccaagatgttg
gataaggaggactttaccatgatgaagcgtgccatctttgccacccagcggcaatgccag
ccccccgtctgcacacacaacatgctggaggatagcagcgaccccatcctcaactgcatc
cgccgcatcggcctcttcaactcagctcaggacagagtcaaagtgatcttccatccagag
tttctctcctcaacttctcctctcttgccgatggactatgaggagtttgtgcgaggctgc
caccttggagtatttccctcttactatgaaccctggggatacacaccagccgagtgtacg
gtgatgggcatcccgtcaatctccactaacctgtctgggtttggctgttttatggaggag
cacattgcagacccatcagcttatggtatctatattctggaccggcggtatcgctcagtg
gatgagtcctgtaatcagctgacatcgttcttgtttcagttctgtcagcagagtcgcagg
caaaggatcattcaaaggaaccgaacagagcgcctcagtgacctgctggactggagatat
ctgggccggtattacgtttctgcccgtcatttggctttagcaaaggcttacccggacaca
tacatctatgaacctcaagaaccctcttcggccgcaggcttccgttatccgcgtcccgcc
tcagtgcctccttcccctgcccactcgcttcactcgtctcctcatcacagcgaggccgag
gatgaggaggaaccatacgatgaagatctggaggctgagaaagatcgagtcaacatccgc
cagccatacaacttacccaacaggaataagaatcaaacagttggtcttcctgagaagaat
taa

DBGET integrated database retrieval system