KEGG   Danio rerio (zebrafish): 394174Help
Entry
394174            CDS       T01004                                 

Gene name
pik3cd, zgc:63473
Definition
phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit delta (EC:2.7.1.153)
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
dre  Danio rerio (zebrafish)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    394174 (pik3cd)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    394174 (pik3cd)
   04370 VEGF signaling pathway
    394174 (pik3cd)
   04630 Jak-STAT signaling pathway
    394174 (pik3cd)
   04068 FoxO signaling pathway
    394174 (pik3cd)
   04070 Phosphatidylinositol signaling system
    394174 (pik3cd)
   04150 mTOR signaling pathway
    394174 (pik3cd)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    394174 (pik3cd)
  Cell growth and death
   04210 Apoptosis
    394174 (pik3cd)
  Cellular commiunity
   04510 Focal adhesion
    394174 (pik3cd)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    394174 (pik3cd)
  Endocrine system
   04910 Insulin signaling pathway
    394174 (pik3cd)
   04914 Progesterone-mediated oocyte maturation
    394174 (pik3cd)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    394174 (pik3cd)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     394174 (pik3cd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
23
AA seq 1039 aa AA seqDB search
MPPGVYGMQEVWEMEGRQHVNIEFLLPTGIYLNFTVACSDTISTIKKMLWKNAKNEPLFS
ALSDPDAYVFTCINMTAEREELEDEQRRLCDVRPFLPILRLVAREGDRVEKLITTQINQL
IGKGHHEFDSQKNHELNEFRTKMRAFCEEHAYLRQTLPWDKWMEYNFPCDLEPCSSVTQS
GKSRSIKKIFVNVKFEGSEETFVLQQDPQDLPVVLKRNALRKKSTVFRSVKQEKPEDYSL
QVNERWEFIYGKYPLCQFKYIFTCLHGGLTPHLTMVHYSSIVKYQEEQSGLSNQVSRSRA
QSKPPPLPLKRQNTCSLWSIQEPFYIYLLQGSRVNADEGMKLVVQAGLFHGSELLCKVVT
SNEVSVCFDPVWDQKLVFDINVSDLPRMSRLCFALYGVIEKTKKRPTKKKNKRADCPLAW
VNTMVFDYKDQLKTGEFSLSTWPSVPDDKGDLLNPMGTVEKNPNIDSTAGLLIRFPNIRP
HPLYYPPIEKLNELGPNGEKVIATKEEHQKLKEIVDNKNSTEFFEDEKEPLWKLREELRL
KYPESLPKLLLITKWNKHEDVAQMVGLLQKWPELPALHALELLDYSFPDPHVRFFTIRCL
RKLPDDKLFQYLLQLVQVLKYESYLDCDLTSFLLERALANKKIGHFLFWHLRSEMHVPSV
SLRFGLILEAYCRGSIFHIKSLMKQNEALNKMKALNDFVKSASQKATRIQTTEDMKVCIK
QETYMEALSDVVSPLSPSIILCELCADKCKFMDSKMKPLWLMYKSKYDSVGIIFKNGDDL
RQDMLTLQMIQIMDILWKTEGLDLRMQPYGCLSTGNKTGLIEVVKNSDTIANIQRNNSNS
AATAAFNKDALLNWLKSKNPGDKLDQAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRES
GQLFHIDFGHFLGNFKSKFGINRERVPFILTYDFVHVIQEGRTNNSEKFERFRVCCEQAY
KILCRNGTLFVNLFALMKAAGLPELNSSKDIQYLKDSLALGKSEEEALKNFKVKFNEALR
ESWKTKVNWMMHTFAKDNR
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgggggtctacggcatgcaggaagtgtgggagatggagggtcggcaacatgtc
aacattgagttcctcctccccacggggatctacctcaattttactgtagcatgcagtgac
accattagtaccatcaagaagatgctgtggaagaacgccaagaacgagcctctgttcagt
gctcttagtgatccagatgcttacgtcttcacctgcatcaacatgaccgctgagcgggaa
gagctggaagacgagcagcgccgcctgtgcgatgttcggccattcctgccaattctcaga
cttgtggcccgggaaggagaccgagtcgagaagctcatcaccacccagatcaatcagctt
atagggaaaggtcatcatgaatttgactcccaaaagaaccacgagttaaacgaattccga
acaaaaatgcgggcattttgtgaagagcatgcctacttgcgtcagacgttaccgtgggac
aagtggatggagtacaacttcccatgtgacctggagccgtgctcttcagtaacccaatct
ggcaaatcacgcagcatcaagaagatctttgtcaatgtgaagtttgagggcagtgaggag
accttcgtcctccagcaagacccacaggacctgccggtggttctgaaacgcaatgctctg
agaaagaagtccactgttttcagatcggttaagcaggagaaaccagaggactacagcctg
caggttaacgagagatgggagttcatttatggaaaatatccactctgccagttcaaatac
attttcacatgtttgcacggaggtcttaccccacacctgacgatggtgcattattcatcc
atcgtcaagtaccaggaggagcagagtggcctcagtaaccaggtgtccagaagccgtgct
cagtccaaaccaccaccgctgcctctgaaaaggcaaaacacatgttcgctgtggtcgatt
caggagcctttctatatataccttctacagggaagtcgagtaaatgcagacgaaggcatg
aagctggtggtccaggcgggcctctttcacggcagtgaactcctgtgtaaagtggtgacc
agcaatgaagtcagtgtttgctttgaccccgtatgggaccagaagctagtgttcgacatc
aatgtgagcgacctgccccgtatgagccgcctctgcttcgccctctacggcgtcattgag
aagaccaagaagcggccaaccaaaaagaaaaacaaaagagcggattgtcctttggcctgg
gtgaacacgatggtgtttgactacaaagatcagctgaagacaggagaattctccctgtcc
acgtggccatcggtcccagacgataaaggcgatttgttgaatcctatgggcactgtggag
aaaaatccaaacatcgacagcacggctggcctcctaattcgctttcccaacatcaggcca
caccccttgtactatccaccaatcgaaaagctaaatgaactgggtcccaatggtgaaaag
gtcattgctacaaaagaagagcaccagaagctgaaagagattgtggacaataaaaactcc
accgagttctttgaggatgagaaggagccgttgtggaagctgcgagaggagctgagactg
aagtacccagagagcctccccaaactcctgctcatcacaaagtggaacaaacatgaggat
gtggctcagatggtcggtttgctacagaaatggccagaattgccagccctacacgctcta
gaacttctagactacagtttcccagaccctcatgtccgcttcttcaccatccgctgcctc
aggaagctgcccgatgataagctgtttcagtatctcttgcagctggttcaggttctaaaa
tacgaatcatacctggactgcgacttgaccagtttcctgctcgaacgagctctggccaac
aagaaaataggtcacttcttgttttggcacctcaggtcagaaatgcatgtaccctcagtc
agcttgagatttggactgattctggaggcctattgtcgtgggagcatctttcacatcaag
agcttgatgaaacagaacgaggctctaaataagatgaaggctctaaatgactttgtaaag
tcggccagtcagaaggcaaccaggatacagactaccgaggatatgaaagtgtgcataaaa
caggagacatacatggaagctctctccgatgttgtttcccctcttagcccaagcatcatt
ctgtgtgaactctgtgcagacaaatgcaagttcatggactcaaagatgaaacctctatgg
ctaatgtacaagagcaaatatgattccgtgggcattattttcaaaaacggagacgatctg
aggcaggacatgttaacccttcagatgattcagataatggatattctatggaaaacagaa
ggtcttgacctcagaatgcagccctatggatgcctttcaaccggcaataaaacaggtctc
atcgaggtggtcaaaaactcagacactatcgccaacatccagagaaacaacagcaacagt
gcagccactgctgccttcaacaaggacgctcttctcaactggctcaagtccaaaaaccca
ggggataaactggatcaagccattgaggaattcaccctttcgtgtgcaggctactgtgta
gctacatatgttctgggaataggtgatcggcacagtgacaatatcatgattagggaatct
gggcagttgttccatatagatttcgggcactttttggggaacttcaagagcaaattcggg
atcaacagggaacgtgtgcctttcattctgacatatgattttgttcatgtaattcaggag
ggacggaccaacaacagtgagaaattcgaaaggtttcgcgtctgttgtgaacaagcctat
aagattctttgccggaacgggactctttttgtgaatctttttgcattgatgaaagctgca
ggtcttccggagctcaattcttccaaagacatccagtatctaaaggactctttggcactg
gggaaatcggaggaggaagcactgaagaactttaaggtcaagtttaatgaagctctacga
gagagttggaagaccaaggtgaactggatgatgcacacatttgccaaagataacagataa

DBGET integrated database retrieval system