KEGG   Danio rerio (zebrafish): 394189Help
Entry
394189            CDS       T01004                                 

Gene name
eif3ja
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit J-A
  KO
K03245  translation initiation factor 3 subunit J
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    394189 (eif3ja)
Ribosome biogenesis [BR:dre03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    394189 (eif3ja)
Translation factors [BR:dre03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    394189 (eif3ja)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF3_subunit CDC45
Motif
Other DBs
NCBI-GeneID: 394189
NCBI-ProteinID: NP_957508
ZFIN: ZDB-GENE-040426-1266
Ensembl: ENSDARG00000012603
Vega: OTTDARG00000035594
UniProt: Q7SXU0
Position
25
AA seq 249 aa AA seqDB search
MADADSWDADSFEPEEPIKKAAVHDKWEGEDEDDDVKDNWDDDEEEEKEEEEEKKTEAKP
TEKKKLSEKIKEKENLQRKKQEELRKQQLEETKRDTPLTPEDELAEKLRVKQLQEDSDLE
LAKEAFGVVSNNVTGIDAVSPSSKDDFTEFERLLKEKISPYEKSIHYSGFLETLFRDLCL
SLEVEDLKKINNSLTVLLSEKQRQEKANKGKKKKKGVLPGGGLKAKMKDDLADYGGFDGG
YAQDYEDFM
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgccgattcttgggatgcggacagtttcgagcctgaggagcccatcaaaaag
gcggcagttcatgacaaatgggagggcgaggatgaggacgacgacgtgaaagataattgg
gatgatgatgaagaggaagaaaaggaggaggaggaggaaaaaaagacagaggctaaacct
acagaaaaaaagaaactcagtgaaaagataaaagaaaaggaaaatttacaaaggaaaaaa
caagaggagctcagaaaacagcagttagaggagacaaaaagagacacaccactcacacca
gaagatgaactggcagagaaactcagagtgaaacaactacaggaggattcagacttagaa
ctagcaaaagaggcatttggtgtagtttcaaataatgttacaggaatcgatgcggtaagt
ccctcttcgaaagacgacttcacagagttcgagaggttgctaaaagaaaaaatatctccc
tatgagaagtctatacactattccggttttttagaaacactgtttagggatctgtgtctt
tcattggaagttgaagacttgaagaaaattaacaactcactaacagtgttactaagtgaa
aaacagaggcaagaaaaggcaaacaaaggtaaaaagaaaaagaagggagttttaccaggg
ggaggtttaaaagccaagatgaaagacgatctggcagattacggcgggtttgacggcggt
tatgcacaagactatgaggacttcatgtga

DBGET integrated database retrieval system