KEGG   Danio rerio (zebrafish): 394189Help
Entry
394189            CDS       T01004                                 

Gene name
eif3ja, eif3j, eif3s1, zgc:63801
Definition
eukaryotic translation initiation factor 3, subunit Ja
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
dre  Danio rerio (zebrafish)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    394189 (eif3ja)
Translation factors [BR:dre03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    394189 (eif3ja)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
25
AA seq 249 aa AA seqDB search
MADADSWDADSFEPEEPIKKAAVHDKWEGEDEDDDVKDNWDDDEEEEKEEEEEKKTEAKP
TEKKKLSEKIKEKENLQRKKQEELRKQQLEETKRDTPLTPEDELAEKLRVKQLQEDSDLE
LAKEAFGVVSNNVTGIDAVSPSSKDDFTEFERLLKEKISPYEKSIHYSGFLETLFRDLCL
SLEVEDLKKINNSLTVLLSEKQRQEKANKGKKKKKGVLPGGGLKAKMKDDLADYGGFDGG
YAQDYEDFM
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgccgattcttgggatgcggacagtttcgagcctgaggagcccatcaaaaag
gcggcagttcatgacaaatgggagggcgaggatgaggacgacgacgtgaaagataattgg
gatgatgatgaagaggaagaaaaggaggaggaggaggaaaaaaagacagaggctaaacct
acagaaaaaaagaaactcagtgaaaagataaaagaaaaggaaaatttacaaaggaaaaaa
caagaggagctcagaaaacagcagttagaggagacaaaaagagacacaccactcacacca
gaagatgaactggcagagaaactcagagtgaaacaactacaggaggattcagacttagaa
ctagcaaaagaggcatttggtgtagtttcaaataatgttacaggaatcgatgcggtaagt
ccctcttcgaaagacgacttcacagagttcgagaggttgctaaaagaaaaaatatctccc
tatgagaagtctatacactattccggttttttagaaacactgtttagggatctgtgtctt
tcattggaagttgaagacttgaagaaaattaacaactcactaacagtgttactaagtgaa
aaacagaggcaagaaaaggcaaacaaaggtaaaaagaaaaagaagggagttttaccaggg
ggaggtttaaaagccaagatgaaagacgatctggcagattacggcgggtttgacggcggt
tatgcacaagactatgaggacttcatgtga

DBGET integrated database retrieval system