KEGG   Danio rerio (zebrafish): 394230Help
Entry
394230            CDS       T01004                                 

Gene name
st3gal5, st3Gal-V, wu:fc08a12
Definition
ST3 beta-galactoside alpha-2,3-sialyltransferase 5 (EC:2.4.99.9)
Orthology
K03370  
lactosylceramide alpha-2,3-sialyltransferase (sialyltransferase 9) [EC:2.4.99.9]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    394230 (st3gal5)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.9  lactosylceramide alpha-2,3-sialyltransferase
     394230 (st3gal5)
Glycosyltransferases [BR:dre01003]
 Terminal extension
  Sialyltransferase
   394230 (st3gal5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
14
AA seq 364 aa AA seqDB search
MRRVMKQSSCYFSKRTMILLLSLALMSLAFLKLPSFHTELKPVEVPVDNKFRKRVHSHVR
EILDKECRPSFARQRMVTEHHGSTPTIDPFLNKNMKLDKQIFQYPPPFGFLDMKNKLEEI
LNLLPVSSEQRLGERDCRRCVVVGNGGILKGLGLGHLLNRFDIIIRLNSGPLQDFSADVG
NRTTIRMSYPESCPKVWEDTDPDLKYVAVIFKSVDFHWLRAMISRTPVSLWDRLFFWQNV
PMSVPVKTSQFHLLNPQIIREMALDLLNYPEPKKRLWSWDQNIPTLGLTALNLATYICDE
VSLAGFGYNLSQKEAPLHYYDSVPMTTILKEAMHNVQKETVFLKRLVASGSITDLTGGIH
CSFC
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaggagagtcatgaaacaatccagctgttatttcagcaaacggacgatgattcttctt
ctgagcttggctttgatgtcactggcgtttttaaagctgccttcctttcatacggaacta
aaacctgtggaagtgccagtagacaataaattcagaaagcgtgtccattctcatgtccga
gagatactagacaaagaatgcagaccttcctttgcccggcagagaatggtgactgaacat
catggctccacaccaacaatagatccttttttgaacaagaacatgaagttagataaacaa
atattccagtatcctccaccctttgggttcctggacatgaagaacaagcttgaggaaatc
ctaaacctcttaccagtttcttctgaacagaggcttggggagcgagattgtcgacgctgt
gtagtggttgggaatggagggatactgaaaggattaggactcggacatctacttaatcgt
ttcgatattatcatcagactgaacagtggtcctcttcaagacttcagtgcagatgttggg
aaccgcaccactatcagaatgagctaccctgaaagctgcccgaaggtctgggaagatacg
gatccagacctcaaatatgtggctgtgatattcaagtctgtagacttccactggcttcgt
gcaatgatcagcaggacaccagtttcgctgtgggacaggctgtttttctggcagaacgtg
ccaatgagcgttccagtcaagacctcccagtttcatctcctgaatccccagattatccgt
gaaatggctttggatctgcttaattatcccgagcctaaaaaacggctctggagctgggac
cagaacatccctacattagggcttacagctctcaatctggcaacatacatatgtgacgag
gtgagcctagcaggctttggctataacctcagccagaaagaggctcctcttcattactat
gacagcgttcccatgacaaccattttaaaggaagccatgcacaatgtacagaaagagact
gtttttctcaaacgtttggtagcctcaggcagtattacggacctcacaggtgggatacac
tgcagcttctgttga

DBGET integrated database retrieval system