KEGG   Danio rerio (zebrafish): 394235Help
Entry
394235            CDS       T01004                                 

Gene name
pfn2, wu:fb01g08, wu:fb54f09, wu:fd58f06
Definition
profilin 2
Orthology
K05759  
profilin
Organism
dre  Danio rerio (zebrafish)
Pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    394235 (pfn2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    394235 (pfn2)
Exosome [BR:dre04147]
 Exosomal proteins
  Proteins found in most exosomes
   394235 (pfn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
22
AA seq 140 aa AA seqDB search
MSWASYVENLMSDGSCQDAAIVGCTAEAKYVWGAQEGGTFANITPTEIDVLVGKDRQSFF
TNGLTLGSKKCSVIRDNLTTEGDWTMDIRTKSQGGEPTYNIAVGKATKTLIMVKGKEGIH
GGQLNKKTYTMAEYLRRSGY
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgggcaagctacgtggaaaacctgatgtcggacggatcgtgccaggacgccgcc
attgttgggtgcaccgcggaggctaaatacgtttggggagcgcaggaagggggaacattc
gcaaacatcacgcccacagaaatcgatgtgctcgtaggcaaagaccgacagagtttcttc
accaatggcctgactttaggttcaaagaagtgctctgttattcgggacaatctgacaacg
gagggtgactggacgatggacatcaggacaaaaagtcaaggaggagagccgacctacaac
atcgctgttggcaaagcaaccaaaacattgattatggtcaagggcaaggaaggtatccat
ggagggcagctcaacaagaaaacgtataccatggctgaatacctgaggagatctggatat
taa

DBGET integrated database retrieval system