KEGG   Danio rerio (zebrafish): 394235Help
Entry
394235            CDS       T01004                                 

Gene name
pfn2, wu:fb01g08, wu:fb54f09, wu:fd58f06
Definition
profilin 2
Orthology
K05759  
profilin
Organism
dre  Danio rerio (zebrafish)
Pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:dre04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:dre05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
22
AA seq 140 aa AA seqDB search
MSWASYVENLMSDGSCQDAAIVGCTAEAKYVWGAQEGGTFANITPTEIDVLVGKDRQSFF
TNGLTLGSKKCSVIRDNLTTEGDWTMDIRTKSQGGEPTYNIAVGKATKTLIMVKGKEGIH
GGQLNKKTYTMAEYLRRSGY
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgggcaagctacgtggaaaacctgatgtcggacggatcgtgccaggacgccgcc
attgttgggtgcaccgcggaggctaaatacgtttggggagcgcaggaagggggaacattc
gcaaacatcacgcccacagaaatcgatgtgctcgtaggcaaagaccgacagagtttcttc
accaatggcctgactttaggttcaaagaagtgctctgttattcgggacaatctgacaacg
gagggtgactggacgatggacatcaggacaaaaagtcaaggaggagagccgacctacaac
atcgctgttggcaaagcaaccaaaacattgattatggtcaagggcaaggaaggtatccat
ggagggcagctcaacaagaaaacgtataccatggctgaatacctgaggagatctggatat
taa

DBGET integrated database retrieval system