KEGG   Danio rerio (zebrafish): 402820Help
Entry
402820            CDS       T01004                                 

Gene name
tmsb
Definition
(RefSeq) thymosin beta
  KO
K05764  thymosin, beta 4
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    402820 (tmsb)
Cytoskeleton proteins [BR:dre04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Thymosin
     402820 (tmsb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymosin DUF4522 WH2
Motif
Other DBs
NCBI-GeneID: 402820
NCBI-ProteinID: NP_991144
ZFIN: ZDB-GENE-050307-5
Ensembl: ENSDARG00000054911
Vega: OTTDARG00000021072
UniProt: Q9W7M8 Q1RM34
Position
21
AA seq 45 aa AA seqDB search
MADKPNMTEITSFDKTKLRKTETQEKNPLPTKETIEQERQGESTP
NT seq 138 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaaacccaacatgactgaaattacatcctttgataaaactaaactcagaaag
acagagacccaagaaaagaaccctttgccaaccaaagaaactattgaacaggagagacaa
ggagagtccacaccgtga

DBGET integrated database retrieval system