KEGG   Danio rerio (zebrafish): 402820Help
Entry
402820            CDS       T01004                                 

Gene name
tmsb, im:7149936, zgc:136504
Definition
thymosin, beta
Orthology
K05764  
thymosin, beta 4
Organism
dre  Danio rerio (zebrafish)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    402820 (tmsb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
21
AA seq 45 aa AA seqDB search
MADKPNMTEITSFDKTKLRKTETQEKNPLPTKETIEQERQGESTP
NT seq 138 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaaacccaacatgactgaaattacatcctttgataaaactaaactcagaaag
acagagacccaagaaaagaaccctttgccaaccaaagaaactattgaacaggagagacaa
ggagagtccacaccgtga

DBGET integrated database retrieval system