KEGG   Danio rerio (zebrafish): 402834Help
Entry
402834            CDS       T01004                                 

Gene name
usp40
Definition
ubiquitin specific peptidase 40
Orthology
K11869  
ubiquitin carboxyl-terminal hydrolase 40 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
6
AA seq 1263 aa AA seqDB search
MFGDLFEEDGDGFSSAPGSGVKGRECEPPPPRGKIKLCGIKNQGGTCYLNSLIQTLLFTP
EFREELFHLGPDELGCLADKDKPEAKVRVIPLELQRLFSHLLLVDEQTASTTDLTDSFGW
TNNEEMGQQDVQELNRILFSALESSLVDTSGSSLIHRLYHGTLVNQITCKECSYISERQE
DFLDLTVSVSGVSGLEEALWNMFVEEEMFEGNNLYRCSGCGQLVRAAKSAKLRKLPPFLT
ISLLRFNFDFTKCERYKETGSYVFPLTFNLRPFCEQSNWPDSEYSYELFSVIIHKGGCYG
GHYHVYIKDIDQLGHWEAPEEEKNVKMKVKTQKQENKTEERKTESENSLETEDPLSVLTG
ILAQEESKCVLVDQLGQKLLNKIGTPWSKKYKKQYGSISKFLQSHPEVFMLISNGTRVAL
KAGVPTEASPPELVNSTAADSCPENTEPETATAGENEDPDQCHWFDLNDSTVTAITVKDI
EKQFQGKESAYMLFYRKTTLKRPPEAIGNPAYKVPPHLLEMVEEENAGLQHKRAEFDASS
NSIEVRLHLAPHYHWQNGALHPSAPGEDSIITVTFDRRKTVGDLRLAIYQMQDLWEGDMA
LTLAKNVPAGLHLYDTLTDDQMSLYSAGVRNGSDLFVWNGREVSGVVVQTGVEWEPVLLT
VLRPSVEELGCSEVSDTDGSGLVRFMKGFAGGATLGTVLEALGPQDALLCQEQSRPGASG
GGASGWRVFPPQDMQRTLRELFLKDGDALLLLQPEELDSSIFSLSGDVVTVTTPSDCRWL
QVEFCPQSGLKEEQEEEEEEQGKKRSKVSASGNMLLAVVKQKAIEELCLQDELGGVECCL
RQMDRTGKLLPPVHEHLSVRDAGIRLMTSLYLCPGPVPTATQLFLYFSVGLVPSVGQELE
IIVEESLTVKECLKKMLEMTRLEGESWHLRRVDWCEEIGEPLMDENASLKEAKVIYGDTL
VLIEGRLPPKGFLKLSVRMYMDMIDSCPELNHSKPQNAEGLATECSGSEMRFMGYVEISE
EASLDDFKTQVMTLPALQDVCVPSPAFMRVWLLEGKKLARILRGNQMTLRKLKLGNGAEV
CIQRLMKEEDLGLKDLLLRVQMGVPGEKAYYPSEEFLWDAGRDGSPKGLYAALAAHYGLA
PDNLLLAKHLPDKHSWMPISNWTQQVSKRKKKRKAESLQAAPFYLKDGDIIGVKNLLIDN
NKEFTTLEDEIGQLRLREEVANQNTRGSTVTGESSLDTGSKKTGSAKNRKPEVALSINVG
MFR
NT seq 3792 nt NT seq  +upstreamnt  +downstreamnt
atgtttggagatctttttgaagaggacggggatggtttttcttctgcacctggttcaggt
gtgaagggaagagagtgcgagcctcctccaccgagagggaaaatcaaactctgcgggatc
aagaatcagggcggcacctgttacctcaactcactcatccagacgctgctcttcacaccc
gagttcagggaggaattgttccatctcggaccggatgaattaggatgtctggctgacaag
gacaaaccggaggcaaaggtccgtgtgattcctctggagcttcagagactgttttcccac
ctgttgctggtggacgagcaaactgcctccaccacagacctgacggacagttttggctgg
acgaacaatgaggaaatgggtcagcaggatgtgcaggagctgaaccggatcttgttcagt
gctctcgagagctctttagtggacacttcgggcagcagcctcatacaccggctgtaccac
gggacgcttgtcaaccagattacctgcaaggagtgcagctatattagcgagagacaggag
gactttctggacctgacagtgtcagtgagtggagtaagtgggcttgaggaggcgctgtgg
aacatgtttgtggaagaggagatgtttgagggtaataacctctaccgctgcagtggttgt
ggtcaactggttcgagccgccaagtctgctaaactgagaaaacttcccccattcctgacc
atttctctgttgagattcaactttgactttaccaagtgtgagcgctacaaagagacgggg
agctacgtttttcctcttacgttcaacctcagaccattttgtgagcagagcaactggcca
gactctgaatattcctacgagctcttctctgtcatcatacataaaggaggctgttatggt
ggtcattatcatgtctacattaaagacattgatcaacttggccactgggaggcaccggag
gaagagaagaatgtgaagatgaaagttaagactcagaagcaagagaacaaaactgaggaa
agaaagactgagagtgagaattctctagaaacagaggatccactttctgttcttactggc
attttggctcaggaggagtcaaaatgtgtgcttgtagaccagctgggccaaaaactactg
aataaaatcggcacgccatggagcaaaaaatataaaaaacagtatggctccatcagcaag
tttctccagagccaccctgaagtgtttatgctgatctctaatggaacccgtgtagctctg
aaagctggtgtaccaacagaagccagtccaccagaactagtcaactccacagcagcggac
agctgcccagagaacacagagccggaaacagccacagcaggagaaaatgaagatcctgat
caatgtcactggtttgacctgaatgactccactgtgacagccattacagtgaaggacatc
gagaagcagtttcaggggaaagagagcgcctacatgctcttttacaggaagacaactctg
aaaagacctccagaggctattggaaaccctgcatacaaagtgccgccccatcttttggag
atggtggaagaggagaatgcaggccttcagcacaaaagggctgagtttgatgccagcagc
aacagcattgaagtgcggctgcatttggcgcctcattaccactggcaaaacggtgccctg
catccttcagctccaggtgaagactccattatcacagtcacctttgaccgcagaaagact
gtgggagacctgcgactggccatctatcagatgcaggatctttgggaaggagacatggcg
ttgactttggctaagaatgtgccggctgggttacatttgtatgatactctgacagatgac
cagatgtctttgtatagcgcaggagtgcgtaacggttctgatctctttgtgtggaatgga
agagaggtcagtggtgtggtggtgcaaaccggtgtggagtgggagcctgttctgctgact
gtgcttcgaccgtctgtagaggagctgggctgtagtgaggtttcagacactgatggatct
ggactggtgcgtttcatgaagggttttgctggtggagctactttaggcacagtgctcgag
gctttagggccccaggatgcccttctgtgtcaggagcagagccgtccaggggccagtgga
ggcggagctagcggatggagggttttcccacctcaggacatgcagaggacgctgagagag
ctgtttctgaaggacggagacgctctactgctgttacagccagaggagctggacagcagt
atcttcagcctcagtggggatgtagttacagtgacgacaccttcagactgccgctggttg
caagtggagttttgcccacagagtggattgaaggaggaacaggaggaggaggaagaggag
caggggaagaagaggagtaaagtctcagcttcagggaacatgctgctggcagtggtaaag
caaaaagctattgaggaactttgccttcaggatgaacttggtggggtcgagtgctgtctg
aggcaaatggatcgaactggaaaacttttacctccagtgcatgagcatctgagtgttcgg
gatgctgggatcaggttgatgacctcactctacctgtgccctggaccagtgccaacagca
acacagttgttcttgtacttcagtgttggtctagtgccctctgtaggccaggagctggag
atcattgtagaggagtctctaaccgtcaaagagtgccttaagaagatgttggagatgact
agactggaaggtgaatcgtggcacttgaggagagtagactggtgtgaggagattggagaa
ccacttatggatgagaatgcatctctaaaggaggcaaaagtcatttatggggacacactg
gtgctgattgagggccgtctgcctccgaagggtttcctcaagctgtctgtgaggatgtac
atggacatgatcgacagctgtccagagctgaatcactctaagcctcaaaacgctgaggga
ctcgccacagagtgctccggatcagagatgagattcatgggttatgtggagatatcagag
gaggcttcacttgatgactttaaaactcaggtgatgactctgccagctcttcaggatgtg
tgtgtgcccagtcccgcgtttatgcgtgtgtggctgctggagggcaagaaactggccagg
atactcagaggaaaccagatgacactcaggaagctgaagctagggaacggggcagaagtg
tgtattcagaggctgatgaaggaagaggacctggggctgaaggatttattgctgagggtt
cagatgggggtgcctggagagaaggcgtattatccttctgaggagtttttgtgggacgcg
gggcgggacggttcacctaagggcctgtacgctgctctggccgcccactacggccttgct
cctgacaacctgctgctggctaaacacctgcctgacaaacacagctggatgcccatctcc
aactggactcaacaggtctcaaaaaggaagaagaagagaaaagctgagagtctccaggca
gctcctttctacctgaaggatggagatattattggagtcaagaatctgctaatagacaat
aataaagaatttaccactctggaggatgagattggccagctgagactcagggaggaggta
gcgaatcaaaacacgaggggtagcactgtcactggagaatcttcactagacaccgggtcc
aagaagacgggctctgctaaaaaccgtaaacccgaggtggccttatcgatcaacgtggga
atgttcaggtaa

DBGET integrated database retrieval system