KEGG   Danio rerio (zebrafish): 402994Help
Entry
402994            CDS       T01004                                 

Gene name
dao.3, zgc:77858
Definition
D-amino-acid oxidase, tandem duplicate 3 (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    402994 (dao.3)
   00330 Arginine and proline metabolism
    402994 (dao.3)
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    402994 (dao.3)
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    402994 (dao.3)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    402994 (dao.3)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     402994 (dao.3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 353 aa AA seqDB search
MKVCIIGAGVIGLSTAQSIYQHFHSRVSPLTIEVYADFFTPLTTSDGAAGLWQPYLYDKG
IVKETQWNKETFDYLLSFINSPDSIKMGIFLQSGYNLCAETAADPSFKDTVLGFRQLTSR
ELEMFPGYSFGWFNTSIMIEGKTYLPWLMDWLKERNVKFYQRKIDSFKELSACGADVIIN
CSGVRSGELQPDPELQPARGQIIKVDAPWIKHWISTHNFSSRGNSAYIIPGSRLVTVGGV
FQVGNWNRLNSSVDHKQIWEAACKLEPSLQHARIVEDWTGLRPARSKVRLERESIRCGGH
SFEVIHNYGHGGFGLTIHRGCAEEAARLFGQFLEQKGLLVQSKSQAAQAKSRL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgtgcatcattggcgcaggggtcatcggtctctccactgctcagagcatctac
cagcacttccacagcagagtctctcctctcaccatagaggtttatgctgatttcttcact
cctctgaccaccagcgatggggcagctggactctggcagccctatctctacgacaaggga
attgtcaaagaaactcaatggaacaaagagacctttgactatctactgagtttcatcaac
tctccagattcaatcaaaatgggtatcttccttcagtctggctacaatctgtgcgctgaa
actgcagcagacccctcatttaaagacacagtgctgggttttcgccaactgaccagtcgt
gaattagagatgtttccgggctacagctttggctggttcaacacttctatcatgattgaa
ggaaaaacatatctgccctggctgatggactggttaaaagaaagaaatgtcaagttttat
caaagaaagattgattcatttaaagagttgtcagcctgtggtgctgatgtgataatcaac
tgctcgggtgttcgctcaggagagctgcagcctgatcctgagctccagccagccagagga
cagatcattaaggtagacgctccctggataaaacactggatctccacacataatttctcg
tctaggggtaattcagcttacatcatacctgggagtcgtttggtcactgttggtggagtt
ttccaagtgggaaactggaatcggctgaacagttctgttgaccataaacaaatctgggaa
gccgcctgcaaacttgagcccagtctacagcatgcgcggatagtagaagactggactggt
ctcagacctgcacgcagtaaagtcagactagagagagaatccatacgatgtggaggacac
tcatttgaggtcatccataactatggacatggaggttttgggctgaccatccatcgtgga
tgtgctgaggaagctgctcggctctttggacagttcctggagcagaaaggcttgcttgtt
caatctaaatcacaagcagcacaagctaaatcacgtctctga

DBGET integrated database retrieval system