KEGG   Danio rerio (zebrafish): 403116Help
Entry
403116            CDS       T01004                                 

Gene name
st6gal2a, St6GalII, st6gal2
Definition
ST6 beta-galactosamide alpha-2,6-sialyltranferase 2a (EC:2.4.99.1)
Orthology
K00779  
beta-galactoside alpha2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:dre00510]
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:dre00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
9
AA seq 514 aa AA seqDB search
MKSSLKQWRRLALGLILVWALLFLALLSYFMESRVDDPHAAAALSYTDTRRLTSLQGNPR
TIMATHLGLATSSAPSTSSNTQQEQSQEENPSADPQPSPLSQEAYPYPDPQSLAAWSAFG
TQDVGSRSTGMSRNRERQEYNQDSPQEDEDEEEEVIGGEEEDEEGGDEGRGRTTKRVARH
GSSDPHEYYVPRYKSIVHGLWKGSLSMGMLSPRLQRAMKDYLNNNKHGVAYRGHRKAKQS
RQQVLCELKKREKIRTLDGAEMPFSKLGWQKIVPALPLSQIHRPGLKTCAVVTSAGAMLH
SGLGKEIDSHDAVLRFNTAPTVGYERDVGNKTTIRIINSQILANPMHRFNRSSLYKNVTL
VAWDPAPYTLNLHKWYSNPDYNLFTPYMEYRMRFPSQPFYILHPKYIWQLWDVIQANNLE
NIQPNPPSSGFIGILLMMSLCEEVHVYEYIPSLRQTDLCHYHERYYDAACTLGAYHPLLY
EKMLIQRMNIGSEDELKRKGKVTLPGFNKVHCEP
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccagtctgaaacagtggcggcggctcgccctcggcctcattctggtctgggca
ctgctcttcctggcgctcctctcttacttcatggagtcaagagtggatgacccgcacgcc
gcggccgctctatcttacacagacacccgacgcctgacctccctgcagggcaaccctcgg
accatcatggccacccatttgggcctggccacctcctccgccccatccacctccagcaac
acccagcaggagcagagccaggaggaaaacccaagcgccgatccccaacctagtccactc
agccaggaagcctacccttaccctgaccctcagagcctggcagcctggtccgcattcggc
acccaggatgtgggctcgaggtcgaccggcatgagtcgcaaccgtgaacgacaagagtac
aaccaggattcacctcaagaagacgaggatgaagaggaggaggtgattgggggggaagag
gaggatgaggagggtggtgatgaaggtagagggaggaccaccaaacgggttgcaaggcat
gggagctctgacccgcatgaatattacgttcccagatacaaatccatagttcatggtctg
tggaaagggagtttgtcgatggggatgctcagtccacgcctgcagagggctatgaaagac
tacctgaataataataagcatggagtggcctacagggggcaccggaaggcgaagcagagc
cgccagcaggtgctgtgtgagctgaaaaaaagggagaagattcgaacattggatggggcc
gagatgcctttctccaaattgggctggcagaagattgtgcctgcattacccctaagccag
atccacaggccaggcttaaagacctgtgctgtggtcacctctgctggagccatgctgcac
tctggacttggcaaggagattgactcccatgatgcagtgctgcggtttaatacagctcct
actgtgggttatgaaagagacgttgggaataaaaccaccatacgcatcatcaactctcag
atcctggcgaatcccatgcataggttcaacagaagctcattgtataaaaatgtaacgctg
gtggcgtgggaccctgcaccgtacaccctcaacctgcacaaatggtactccaatccagac
tacaacctcttcacaccatacatggagtacaggatgcgcttcccttctcagcctttctac
atcctgcaccccaagtacatctggcagttatgggacgtgattcaagctaataatctggag
aacatccagcccaatccaccctcctcagggttcataggcatcctgctaatgatgtcctta
tgtgaagaggtgcatgtgtacgagtacattccctccctgcgtcagacggacctgtgccat
tatcacgagcgctactacgatgccgcctgcactctgggtgcgtatcatcctctgctctac
gagaagatgctcatccagcgcatgaacatcggctcagaggatgagctcaaacgcaaaggc
aaagtcacactgcccggattcaacaaagtccactgtgagccttga

DBGET integrated database retrieval system